KEGG   Danio rerio (zebrafish): 556535Help
Entry
556535            CDS       T01004                                 

Gene name
setd1a
Definition
(RefSeq) histone-lysine N-methyltransferase SETD1A isoform X1
  KO
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
dre  Danio rerio (zebrafish)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    556535 (setd1a)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     556535 (setd1a)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     556535 (setd1a)
   HMT complexes
    COMPASS/SET1 complex
     556535 (setd1a)
    COMPASS/SET1 complex (yeast)
     556535 (setd1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 2253 aa AA seqDB search
MDPDSGADTQRTLSLQWKSYKLVQDPALRRVTQKIYRYDGIHFSVPDSGFPPVGDLRDPR
PRRIWSRHTELSLPVPKFKLDEYYVGPIPLKEVTFARLNDNIKEPFLAEMCAKFGEVEEM
EILFHPKTRKHLGLARVLFTNTRGAKDTVKHLHNTSVMGNIVHVQLDIKGQQRMKYYDLI
VSGSYTPQTVPTGGKALTEKFQPPVPTQPDTSSDIRRRLSTDQMAAPAAATLNSGSTTPC
SVDTGFGDQRLDTPPSSMGGPYTPGSSASSQGGGTPYTPRSGTPFSQDSGYSVARHGGYS
STQSFPQQDMLPSSSCSSSAVSSSSGFKPPRFHDDLHAPPPQDVFQRGRPGFPASAPFRP
NEPPYPYPSAGGSGMHMPLHPPVPPQFEQPPLSDRERERDRERGHRDRERDSGGGRYGGG
ISSRRSTYPYQQETNSSSTSKTYHAHHSHHADRREDRDGRGYRRDSSGSRSGDHSRHRNH
HHSHNHHSGGGGSSRRRSSRDREWERDRDGEFNPSDPRYGSHSNSSHHSSNSLSPPSATS
SFGGFSSSKDLSPYDTPSSSRLEPSSAFRPQQGAGERAFGMGGSMDNDYRGHSHHTPLAP
PPPPPPLPPASVIAAAVAETLSSLDFGQDSPIREEQWTKPKRHPSTPPLPPRTPPTSSPP
HASIPSSSTSPSSTSLPHHLPSSTASLSPPPPQRDSSPEPDSTNESLPFMHHSSSLDSRI
EMLLKEQKAKFSFLASDDEDDEKDEVRERGKSENSKDGGNKLREHGGERPSHKRQGEMEA
GQQRRRGEKDGRRSRGKRQVSGVGEGRKTPPEVASSTPTVHSLVSESLQGQIPPPQEEHT
TSDTHRAPHTPPTYNGEAQPSPRSSGEDMEISDEDDNTITTATSHPAASSSSSPAASSQT
VLPSQTTDPSASPAPDTSQHFSATMPPPPIPSYPPHLPPPPLPGFSLQPPPPPGIPPPLP
HMELHPEYPPPLPHHMYDYASSMELMSQYCGGAPMSFQMQTHMLSRLHQMRMASSNSTAA
PPAEVPPASEYPPSYHLHSIPPPHAPPHHPHHPYMDQDGNVASHYDQDHRYIPPPLPYAY
PDPHAAQLPHHHTIPPPHTPWPPHLLPQQFPSHYPPPGFGAVPGVDGELYGAAGDQMAIM
GHNPCEAVVQQVLAALIEEMKNIMQRDLNRKMVENVAFGTFDEWWDRKERKAKPFQTAMR
GVAVVREEEKKEEKTTTTMTTSNRPREPLMSLVDWAKSGGMEGFSLRGALRLPSFKVKRK
EPQELVEGDELKRARPSTPPDEEDEDSYQGKSADAAAGRTEERRVAERGAARRRSRAKAR
KPYELDSEGEETSDGSSSEKEDEDSDKVDESEDEALSADSDDESVSSSSSESSSSSSASS
SSSDEEDEEEGEQAAESESLDTMDESTMDSVAAVDTEKDERDKASLDQPSVTTPEDKQEE
EKSATPVPPSSPYPRPSSPILLLPPLKKRRKTVSFSMEESEVKPSVQSSTASSPSPSPVS
QASDVPPSVSPVSTPTPAAPSASSKPVPMLLPFASRPSESSALTSPASPSAILTVPPPVR
SLRPDEPKKSPGPPPSPQTPPPKNSTKRGKDSPRTPPAPVCLTVQNLPLDHASMVKMAYE
DPVPLPTTQKGRARGRPRTLSQSASASHLHPALEEEDEDEEELEQRLKLREQLGVSSLLQ
LASAPKPDLSVLADVALKMDPEADIDSEETETSDEAEEHKLEEEEGDFFAPHPRQPLLDP
EGLFVMQEHNYSKTPAPQHITPPQKKTKQDSTVLLPADLNQHGVQEAPEEVIGEALAARA
EAPELYGDLDLLCDGREAAETQTKTLSSPYKRTGSISKEVELEERGKGKNKKRSRKDKEN
EELQTSKKQKEKQVKKQKKRKLEEFEEDVDVEQLESGELSSSTSDSGDSDFGLERSLEFE
KEEVRKSERLFLQEAGLTPSTQRRPKHTPESLPIPRPSYKNRSEFEQMTILYDIWNSGLD
QEDMRLLKSTYEKLLQDDHGTDWLNDTHWVPHTITNIPNPRRKKKTADGQLREHVTGCAR
SEGYYAISRKEKDVYLELDQPVTLREIGDYDTAGSNRVLSERRSEQRRLLSAIGTPAVMD
SDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQSIRQMVADNREKRY
AQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPI
GVNEEITYDYKFPIEENKIPCLCGTESCRGTLN
NT seq 6762 nt NT seq  +upstreamnt  +downstreamnt
atggatccggacagtggggcggacactcagcgaactctcagtctgcaatggaaaagctat
aagctagtacaagaccctgccctccggcgggttactcagaaaatctacagatatgatggg
attcactttagtgttccggattcaggatttccgcctgtgggggacttgcgtgatccgaga
ccccgcagaatctggtcaagacacacagagctgtcgctgccagtgcccaaatttaagttg
gacgagtattacgtaggccctattccgcttaaggaagtgacgttcgcaagactgaatgat
aacataaaggagccgttcctggcagaaatgtgcgccaagtttggtgaggttgaggaaatg
gagattttgtttcatcctaagacacggaagcacttgggcttggcccgcgtcctcttcacc
aacactagaggggccaaagacacagtcaaacacctgcacaacacttctgtcatgggaaac
attgtccatgtccagctggatatcaaaggccaacagaggatgaagtattatgacttgata
gtaagcggctcatacacccctcagacagtgccgaccggaggcaaagctctcacagagaaa
tttcagccccctgttccaacacaaccagatacgtcttctgatatccggcggaggctctct
acagaccagatggcagctcctgctgctgcaactctgaactctggcagtaccaccccctgt
tctgtggacactgggtttggagatcagcgccttgacactcctccatcttcaatgggcgga
ccctatacaccaggctcctctgcttcttcacagggtgggggcaccccgtatactccacgc
tctggaacccctttctcccaggactcgggctactctgttgccaggcatggtggctatagc
agcactcagagtttcccccagcaggatatgcttccatcgtcctcctgctcctcctcagcg
gtctcctcgtcatcagggtttaagccccctcgctttcatgatgacctacatgctccacct
ccacaagatgtgttccagaggggtcggcctggatttcctgcatctgcacctttcagacct
aatgaacctccctatccgtatcccagtgctggtggttcagggatgcacatgcccttacat
ccacctgtaccacctcaatttgagcaacccccactgtctgacagggagagagagagagac
agagaaaggggacaccgggatcgggagagagactctggaggagggcgctatggaggtgga
ataagctccagacgctccacctacccatatcaacaagaaaccaactcctcttccacttcc
aaaacctaccatgcacaccactcgcatcatgctgaccggcgagaggacagggacggcagg
ggctacaggcgggatagttcaggctcacgttcaggagatcacagtaggcatcggaaccac
catcactcccacaaccaccacagtggcggaggaggctcgagtcgacgaagaagcagcaga
gaccgggagtgggagcgagatagagatggagaattcaacccatctgatccacgttatggg
agccactcgaactctagccaccactcctccaatagtctctcccctccctctgctacctcc
tcatttggaggattctcctcatctaaagacttgtccccttacgacacaccctcctcctct
cggctggagccctcgtcggccttccgtccccagcaaggtgcaggtgagagggcttttggg
atgggaggaagcatggacaatgactatcgtggtcattcacaccatacacccctggcgcct
ccaccgcctccgcctccccttccgccagcctctgtcattgcagctgctgtggctgagaca
ctcagctcgcttgatttcggtcaggacagtcccatcagagaagaacaatggaccaaaccc
aaacgccatcccagcaccccgccccttccacctcggacacctccaacctcctcacctccc
cacgcctccatcccatcatcatctacctccccgtcctccacttcactgccacaccatctt
ccttcttccacggcatccctctctccgcctcctccacagcgtgactcttctccagagcct
gactccaccaatgagagcctgccgttcatgcaccacagcagcagcttggactcacgtatt
gagatgttgctgaaggaacaaaaggccaagttttctttccttgcctcagatgatgaggat
gatgagaaggatgaggtcagagagagaggaaaatcagagaacagcaaagatggtggaaac
aaactccgagagcatggtggagaaagacccagtcacaagagacaaggagagatggaggca
ggtcaacagaggaggagaggagagaaagatggacggcgcagcaggggcaaaaggcaagtt
agtggtgtaggggaaggaaggaaaacgccaccagaggtggcgtcctccactcccactgta
cacagtttagtgtcagagtctcttcagggccaaatacctccacctcaggaagagcacaca
acctctgacacacacagggctccacatacaccacccacctacaatggtgaagcacagccg
tctcctcgctcgtctggtgaagatatggaaatatctgacgaagatgacaacaccatcacc
acagcgacatcccatcccgcagcttcttcatcctcttcaccagcagcttcctcacagact
gtcctcccatcccaaaccacagacccctctgcaagccctgcccctgacaccagccagcac
ttcagcgccaccatgccacctccacccatcccatcttaccctccccacctccctcctcca
ccccttcccggcttctccctgcagccccctccaccccctggcatacctcctccacttcca
cacatggagctgcaccccgagtaccctcctccgctgccccaccacatgtacgattatgcc
agctccatggagctcatgagccagtactgtggaggagcgcccatgtcattccagatgcag
acacacatgctcagtcgtctccaccagatgcgaatggcctcctccaacagcacagcagcc
ccacctgcagaagtcccgcccgcttctgaatatcctccttcgtatcaccttcattcaata
ccccctccgcatgcaccgccacaccaccctcaccacccgtacatggaccaagatgggaat
gttgccagccattatgatcaggaccaccgctacatccctcctcctttaccgtacgcatac
ccagaccctcatgcagctcagcttccccaccatcacaccatcccacctccacacaccccc
tggcctcctcacttactgccccaacagtttccttcccactatcctcctcctggctttggc
gcagtgcccggcgtggatggagaactgtatggagcggcaggcgaccagatggccataatg
ggccacaacccttgtgaggctgtagtgcagcaggttctggcagctttgatcgaggagatg
aagaacatcatgcagagggacctcaaccgcaagatggtggagaatgtcgcttttggtacc
tttgatgagtggtgggaccgcaaggagcggaaagctaagccattccagacagccatgcga
ggagttgcggtggtgcgtgaggaggagaagaaggaggagaagacgacgacgacgatgaca
acaagcaatcgacctagagagccactcatgtctctggtagactgggctaagagtggaggc
atggagggtttctccctgcggggggcattacgtttgccttctttcaaggtgaagaggaaa
gagcctcaggagcttgtggagggtgatgagctgaagagagccagaccttctactccacca
gatgaagaagatgaggactcctatcagggtaaatctgccgacgctgcagccggaagaaca
gaggagcgacgtgtggcagaaagaggagcagccaggaggaggagcagagccaaggcacgc
aagccatacgagctggacagcgaaggagaagagacatcagatgggtcctcttctgagaag
gaggatgaagacagtgacaaagtggatgagtcagaagatgaagcccttagtgcagacagt
gatgacgagagtgtttcttcctcctcttctgagagctcatcatcctcctcagcgtcgtcc
tcttcttctgatgaggaagatgaagaggaaggtgagcaggctgcagagagcgagtcattg
gacacaatggatgagtctacgatggacagtgtggcagcggtagacacagaaaaggatgaa
agggacaaagcaagtttagaccaaccatcagtgaccactccagaggacaaacaagaagaa
gagaaatcagctacacctgtgcctccatcttctccgtaccctcgtccttcttcacccatt
ctcctccttcccccactcaagaaacggcgcaagaccgtttctttctcaatggaagaaagc
gaggtcaagccatccgttcagtcatctactgcttcctctccatctccctctcctgtttca
caagcttcagatgttcctccatccgtgtctcctgtaagcacacccacaccagcagctcct
tctgcctcctctaagcccgtcccgatgctccttccgtttgcttctcgtcccagtgaaagc
agtgccctgacctcccctgcttctccttcagccattcttaccgtccctccacctgtgcgt
tccttgcggcctgatgagcccaaaaagagtccaggtccccctccatccccacaaactccc
cctcccaaaaactcaaccaaacgtggcaaagactctccccgaacaccccctgcgcctgtc
tgcctcacggtccaaaatctccctctcgaccatgcctccatggtcaaaatggcctacgag
gatcccgtcccattgccaacaacacaaaagggccgtgcacgtggtcgccctcggacactc
agccagtcggcatcagcttctcatcttcatcctgctctggaggaagaggacgaggatgaa
gaggagctggagcagcggttgaaactcagggaacagctgggagtgtccagcctgctgcag
cttgcctctgcccccaagcctgacctctctgttctggccgatgtggcgctcaagatggac
ccggaggccgatattgactcagaagaaactgagacctctgacgaggcagaggagcacaag
ctggaggaagaagagggagacttctttgccccgcacccacgccaaccactactggatcca
gagggtctatttgtcatgcaggagcacaactattctaaaactcctgcacctcaacacatt
acgcctccacagaagaagacgaaacaagactccaccgtcctgcttcctgcagatctcaat
cagcacggggttcaggaagctcctgaagaggtcatcggagaagctcttgctgccagggct
gaggctccagagctatatggggatctggacctgctgtgtgatggcagggaggcggcggaa
acgcagaccaagacccttagctcaccatacaagaggaccggctcgatcagcaaagaggtg
gaattggaggagagggggaaaggtaaaaacaagaagagaagtaggaaggacaaagagaat
gaggaactacagacttcaaagaaacagaaagagaagcaggtcaagaaacagaagaaacgg
aagttagaggaatttgaagaagatgtggatgtggagcagttagaatctggtgagctttcc
agctccacctctgactctggagactctgacttcggtctggagcgatcgctggagtttgaa
aaagaagaggttagaaaaagcgaacgccttttcctgcaggaagctggcctgactccctcg
acccagaggcgacccaaacacacgcctgaatctctgcctataccccgtccctcttacaag
aaccgcagcgagtttgagcagatgaccatcttgtatgacatctggaactctggcctggac
caggaagatatgagactcctaaagagcacctatgagaaactgctgcaggatgatcatggc
acggactggctcaatgacacacactgggtccctcatactatcaccaacatcccgaacccc
cggcggaagaagaagacagcagatgggcagctcagagagcacgtcaccggctgtgctcgt
agtgaaggctactatgccatcagccgcaaggagaaggacgtctaccttgaacttgaccag
ccggtgacattgcgggaaattggggactacgatactgcaggctcaaatcgtgtgctgtct
gaaaggcgctcagagcagcggcgtctcctcagtgctatcggcactccagcagtgatggac
tcagacctgttaaaactgaaccagctcaagttccgcaagaagaagttgaggtttggccgc
agccgtattcacgaatggggtttgtttgctatggagcccattgctgctgacgagatggtc
attgaatatgtgggacagagcatcagacagatggtggctgataatcgggagaagcgatat
gcccaggaaggcatcgggagcagttatctattccgtgtcgaccatgacactatcattgat
gccacaaagtgtggtaacttggctcggtttattaaccactgctgcacacccaactgctac
gccaaagtgatcaccatcgagtcccagaagaagatcgtgatatactccaagcagcctatt
ggtgtaaatgaggagatcacatacgattacaagttccccatcgaagagaacaaaatccca
tgtctatgtggtacagagagctgcagaggaaccctcaactga

DBGET integrated database retrieval system