KEGG   Danio rerio (zebrafish): 556535Help
Entry
556535            CDS       T01004                                 

Gene name
setd1a
Definition
SET domain containing 1A
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
dre  Danio rerio (zebrafish)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    556535 (setd1a)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     556535 (setd1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 2253 aa AA seqDB search
MDPDSGADTQRTLSLQWKSYKLVQDPALRRVTQKIYRYDGIHFSVPDSGFPPVGDLRDPR
PRRIWSRHTELSLPVPKFKLDEYYVGPIPLKEVTFARLNDNIKEPFLAEMCAKFGEVEEM
EILFHPKTRKHLGLARVLFTNTRGAKDTVKHLHNTSVMGNIVHVQLDIKGQQRMKYYDLI
VSGSYTPQTVPTGGKALTEKFQPPVPTQPDTSSDIRRRLSTDQMAAPAAATLNSGSTTPC
SVDTGFGDQRLDTPPSSMGGPYTPGSSTSSQGGGTPYTPRSGTPFSQDSGYSVARHGGYS
STQSFPQQDMLPSSSCSSSAVSSSSGFKPPRFHDDLHAPPPQDVFQRGRPGFPASAPFRP
NEPPYPYPSAGGSGMHMPLHPPVPPQFEQPPLSDRERERDRERGHRDRERDSGGGRYGGG
ISSRRSTYPYQQETNSSSTSKTYHAHHSHHADRREDRDGRGYRRDSSGSRSGDHSRHRNH
HHSHNHHSGGGGSSRRRSSRDREWERDRDGEFNPSDPRYGSHSNSSHHSSNSLSPPSATS
SFGGFSSSKDLSPYDTPSSSRLEPSSAFRPQQGAGERAFGMGGSMDNDYRGHSHHTPLAP
PPPPPPLPPASVIAAAVAETLSSLDFGQDSPIREEQWTKPKRHPSTPPLPPRTPPTSSPP
HASIPSSSTSPSSTSLPHHLPSSTASLSPPPPQRDSSPEPDSTNESLPFMHHSSSLDSRI
EMLLKEQKAKFSFLASDDEDDEKDEVRERGKSENNKDGGNKLREHGGERPSHKRQGEMEA
GQQRRRGEKDGRRSRGKRQVSGVGEGRKTPPEVASSTPTVHSLVSESLQGQIPPPQEEHT
TSDTHRAPHTPPTYNGEAQPSPRSSGEDMEISDEDDNTITTATSHPAASSSSSPAASSQT
VLPSQTTDPSASPAPDTSQHFSTTMPPPPIPSYPPHLPPPPLPGFSLQPPPPPGIPPPLP
HMELHPEYPPPLPHHMYDYASSMELMSQYCGGAPMSFQMQTHMLSRLHQMRMASSNSTAA
PPAEVPPASEYPPSYHLHSIPPPHAPPHHPHHPYMDQDGNVASHYDQDHRYIPPPLPYAY
PDPHAAQLPHHHTIPPPHTPWPPHLLPQQFPSHYPPPGFGAVPGVDGELYGAAGDQMAIM
GHNPCEAVVQQVLAALIEEMKNIMQRDLNRKMVENVAFGTFDEWWDRKERKAKPFQTAMR
GVAVVREEEKKEEKTTTTMTTSNRPREPLMSLVDWAKSGGMEGFSLRGALRLPSFKVKRK
EPQELVEGDELKRARPSTPPDEEDEDSYQGKSADAAAGRTEERRVAERGATRRRSRAKAR
KPYELDSEGEETSDGSSSEKEDEDSDKVDESEDEALSADSDDESVSSSSSESSSSSSASS
SSSDEEDEEEGEQAAESESLDTMDESTMDSVAAVDTEKDERDKASLDQPSVTTPEDKQEE
EKSATPVPPSSPYPRPSSPILLLPPLKKRRKTVSFSMEESEVKPSVQSSTASSPSPSPVS
QASDVPPSVSPVSTPTPAAPSASSKPVPMLLPFASRPSESSALTSPASPSAILTVPPPVR
SLRPDEPKKSPGPPPSPQTPPPKNSTKRGKDSPRTPPAPVCLTVQNLPLDHASMVKMAYE
DPVPLPTTQKGRARGRPRTLSQSASASHLHPALEEEDEDEEELEQQLKLREQLGVSSLLQ
LASAPKPDLSVLADVALKMDPEADIDSEETETSDEAEEHKLEEEEGDFFAPHPRQPLLDP
EGLFVMQEHNYSKTPAPQHNTPPQKRTKQDSTVLLPADLNQHGVQEAPEEVIGEALAARA
EAPELYGDLDLLCDGREAAETQTKTLSSPYKRTGSISKEVDLEERGKGKNKKRSRKDKEN
EELQTSKKQKEKQVKKQKKRKLEEFEEDVDVEQLESGELSSSTSDSGDSDFGLERSLEFE
KEEVRKSERLFLQEAGLTPSTQRRPKHTPESLPLPRPSYKNRSEFEQMTILYDIWNSGLD
QEDMRLLKSTYEKLLQDDHGTDWLNDTHWVPHTITNIPNPRRKKKTADGQLREHVTGCAR
SEGYYAISRKEKDVYLELDQPVTLREIGDYDTAGSNRVLSERRSEQRRLLSAIGTPAVMD
SDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQSIRQMVADNREKRY
AQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPI
GVNEEITYDYKFPIEENKIPCLCGTESCRGTLN
NT seq 6762 nt NT seq  +upstreamnt  +downstreamnt
atggatccggacagtggggcggacactcagcgaactctcagtctgcaatggaaaagctat
aagctagtacaagaccctgccctccggcgggttactcagaaaatctacagatatgatggg
attcactttagtgttccggattcaggatttccgcctgtgggggacttgcgtgatccgaga
ccccgcagaatctggtcaagacacacagagctgtcgctgccagtgcccaaatttaagttg
gacgagtattacgtaggccctattccgcttaaggaagtgacgttcgcaagactgaatgat
aacataaaggagccgttcctggcagaaatgtgcgccaagtttggtgaggttgaggaaatg
gagattttgtttcatcctaagacacggaagcacttgggcttggcccgcgtcctcttcacc
aacactagaggggccaaagacacagtcaaacacctgcacaacacttctgtcatgggaaac
attgtccatgtccagctggatatcaaaggccaacagaggatgaagtattacgacttgata
gtaagcggctcatacacccctcagacagtgccgaccggaggcaaagctctcacagagaaa
tttcagccccctgttccaacacaaccagatacgtcttctgatatccgtcggaggctctct
acagaccagatggcagctcctgctgctgcgactctgaactctggcagtaccaccccctgt
tctgtggacactgggtttggagatcagcgccttgacactcctccatcttcaatgggcgga
ccctatacaccaggctcctctacttcttcacagggtgggggcaccccgtatactccacgc
tctggaacccctttctcccaggactcgggctactctgttgccaggcatggtggctatagc
agcactcagagtttcccccagcaggatatgcttccatcgtcctcctgctcctcttcagcg
gtctcctcgtcatcagggtttaagccccctcgctttcatgatgacctacatgctccacct
ccacaagatgtgttccagaggggtcggcctggatttcctgcatctgcacctttcagacct
aatgaacctccctatccgtatcccagtgctggtggttcagggatgcacatgcccttacat
ccacctgtaccacctcaatttgagcaacccccactgtctgacagggagagagagagagac
agagaaaggggacaccgggatcgggagagagactctggaggagggcgctatggaggtgga
ataagctccagacgctccacctacccatatcaacaagaaaccaactcctcttccacttcc
aaaacctaccatgcacaccactcgcatcatgctgaccggcgagaggacagggacggcagg
ggctacaggcgggatagttcaggctcacgttcaggagatcacagtaggcatcggaaccac
catcactcccacaaccaccacagtggcggaggaggctcgagtcgacgaagaagcagcaga
gaccgggagtgggagcgagatagagatggagaattcaacccatctgatccacgttatggg
agccactcgaactctagccaccactcctccaatagtctctcccctccctctgctacctcc
tcatttggaggattctcctcatctaaagacttgtccccttacgacacaccctcctcctct
cggctggagccctcgtcggccttccgtccccagcaaggtgcaggtgagagggcttttggg
atgggaggaagcatggacaatgactatcgtggtcattcacaccatacacccctggcgcct
ccaccgcctccgcctcctcttccgccagcctctgtcattgcagctgctgtggctgagaca
ctcagctcgcttgatttcggtcaggacagtcccatcagagaagaacaatggaccaaaccc
aaacgccatcccagcaccccgccccttccacctcggacacctccaacctcctcacctccc
cacgcctccatcccatcatcatctacctccccgtcctcaacttccctgccacaccatctt
ccttcttccacggcatccctctctccgcctcctccacagcgtgactcttctccagagcct
gactccaccaatgagagcctgccgttcatgcaccacagcagcagcttggactcacgtatt
gagatgttgctgaaggaacaaaaggccaagttttctttccttgcctcagatgatgaggat
gatgagaaggatgaggtcagagagagaggaaaatcagagaacaacaaagatggtggaaac
aaactcagagagcatggtggagaaagacccagtcacaagagacaaggagagatggaggca
ggtcaacagaggaggagaggagagaaagatggacggcgcagcaggggcaaaaggcaagtt
agtggtgtaggggaaggaaggaaaacgccaccagaggtggcgtcttccactcccactgta
cacagtttagtgtcagagtctcttcagggccaaatacctccacctcaggaagagcacaca
acctctgacacacacagggctccacatacaccacccacctacaatggtgaagcacagccg
tctcctcgctcgtctggtgaagatatggaaatatctgacgaagatgacaacaccatcacc
acagcgacatcccatcccgcagcttcttcatcctcttcaccagcagcttcctcacagact
gtcctcccatcccaaaccacagacccctctgcaagccctgcccctgacaccagccagcac
ttcagcaccaccatgccacctccacccatcccatcttaccctccccacctccctcctcca
ccccttcccggcttctccctgcagccccctccaccccctggcatacctcctccacttcca
cacatggagctgcaccccgagtaccctcctccgctgccccaccacatgtacgattatgcc
agctccatggagctcatgagccagtactgtggaggagcgcccatgtcattccagatgcag
acacacatgctcagtcgtctccaccagatgcgaatggcctcctccaacagcacagcagcc
ccacctgcagaagtcccgcccgcttctgaatatcctccttcgtatcaccttcattcaata
ccccctccgcatgcaccgccacaccaccctcaccacccgtacatggaccaagatgggaat
gttgccagccattatgatcaggaccaccgctacatccctcctcctttaccatacgcatac
ccagaccctcatgcagctcagcttccccaccatcacaccatcccacctccacacaccccc
tggcctcctcacttactgccccaacagtttccttcccactatcctcctcctggctttggc
gcagtgcccggcgtggatggagaactgtatggagcggcaggcgaccagatggccataatg
ggccacaacccctgtgaggctgtagtgcagcaggttctggcagctttgatcgaggagatg
aagaacatcatgcagagggacctcaaccgcaagatggtggagaatgtcgcttttggtacc
tttgatgagtggtgggaccgcaaggagcggaaagctaagccattccagacagccatgcga
ggagttgcggtggtgcgtgaggaggagaagaaggaggagaagacgacgacgacgatgacg
acaagcaatcgacctagagagccactcatgtctctggtagactgggctaagagtggaggc
atggagggtttctccctgcggggggcattgcgtttgccttctttcaaggtgaagaggaaa
gagcctcaggagcttgtggagggtgatgagctgaagagagccagaccttctactccacca
gatgaagaagatgaggactcctatcagggtaaatctgccgacgctgcagccggaagaaca
gaggagcggcgtgtggcagaaagaggagcaaccaggaggaggagcagagccaaggcacgc
aagccatacgagctggacagcgaaggagaagagacatcagatgggtcctcttctgaaaag
gaggatgaagacagtgacaaagtggatgagtcagaagatgaagcccttagtgcagacagt
gatgacgagagtgtttcttcctcctcttctgagagctcatcatcctcctcagcgtcgtcc
tcttcttctgatgaggaagatgaagaggaaggtgagcaggctgcagagagcgagtcattg
gacacaatggatgagtctacgatggacagtgtggcagcggtagacacagaaaaggatgaa
agggacaaagcaagtttagaccaaccatcagtgaccactccagaggacaaacaagaagaa
gagaaatcagccacacctgtgcctccatcttctccgtaccctcgtccttcttcacccatt
ctcctccttcccccactcaagaaacggcgcaagaccgtttctttctcaatggaagaaagc
gaggtcaagccatccgttcagtcatctactgcttcctctccatctccctctcctgtttca
caagcttcagatgttcctccatccgtgtctcctgtaagcacacccacaccagcagctcct
tctgcctcctctaagcccgtcccgatgctccttccgtttgcttctcgtcccagtgaaagc
agtgccctgacctcccctgcttccccttcagccattcttaccgtccctccacctgtgcgt
tccttgcggcctgatgagcccaaaaagagtccaggtccccctccatccccacaaactccc
cctcccaaaaactcaaccaaacgtggcaaagactctccccgaacaccccctgcgcctgtc
tgcctcacggtccaaaatctccctctcgaccatgcctccatggtcaaaatggcctacgag
gatcccgtcccattgccaactacacaaaagggccgtgcacgtggtcgccctcggacactc
agccagtcggcatcagcttctcatcttcatcctgctctggaggaagaggacgaggatgaa
gaggaactggagcagcagttgaaactcagggaacaactgggagtgtccagcctgctgcag
ctcgcctctgcccccaagcctgacctctctgttctggccgatgtggcgctcaagatggac
ccggaggccgatatcgactcagaagaaactgagacctctgacgaggcagaagagcacaag
ctggaggaagaagaaggagacttttttgccccgcacccacgccaaccactcctggatcca
gagggtctattcgtcatgcaggagcacaactattctaaaactcctgcacctcaacacaat
acgcctccacagaagaggacgaaacaagactccaccgtcctgcttcctgcagatctcaat
cagcacggggttcaggaagctcctgaagaggtcatcggagaagctcttgctgccagggct
gaggctccagagctatatggggatctggacctgctgtgtgatggcagggaggcggcggaa
acacagaccaagacccttagctcaccatacaagaggaccggctcgatcagcaaagaggtg
gatttggaggagagggggaaaggtaaaaacaagaagagaagtaggaaggacaaagagaat
gaagaactacagacttcaaagaaacagaaagagaagcaggtcaagaaacagaagaaacgg
aagttagaggaatttgaagaagatgtggatgtggagcagttagaatctggtgagctttcc
agctccacctctgactctggagactctgacttcggtctggagcgatcactggagtttgaa
aaagaagaggttagaaaaagcgaacgccttttcctgcaggaagctggcctgactccctcg
acccagcggcgacccaaacacacgcctgaatctctacccttaccccgtccctcctacaag
aaccgcagcgagtttgagcagatgaccatcctgtatgacatctggaactctggcctggac
caggaagatatgagactcctaaagagcacctatgagaaactgctgcaggatgatcatggc
acggactggctcaatgacacacactgggtccctcatactatcaccaacatcccaaacccc
cggcggaagaagaagacagcagatgggcagctcagagagcacgtcactggctgtgctcgt
agtgaaggctactatgccatcagtcgcaaggagaaggatgtctaccttgaacttgaccag
ccagtgacattgcgggaaattggggactacgatactgcaggctcaaatcgtgtgctgtct
gaaaggcgctcggagcagcggcgtctcctcagtgctatcggcactccagcagtgatggac
tcagacctgttaaaactgaaccagctcaagttccgcaagaagaagttgaggtttggccgc
agccgtattcacgaatggggtttgtttgctatggagcccattgctgctgacgagatggtc
attgaatatgtgggacagagcatcagacagatggtggctgataatcgggagaagcgatat
gcccaggaaggcatcgggagcagttatctattccgtgtcgaccatgacactatcattgat
gccacaaagtgtggtaacttggctcggtttattaaccactgctgcacacccaactgctac
gccaaagtgatcaccatcgagtcccagaagaagatcgtgatatactccaagcagcctatt
ggtgtaaatgaggagatcacatacgattacaagttccccatcgaagagaacaaaatccca
tgtctatgtggtacagagagctgcagaggaaccctcaactaa

DBGET integrated database retrieval system