KEGG   Danio rerio (zebrafish): 556582Help
Entry
556582            CDS       T01004                                 

Gene name
grik4
Definition
glutamate receptor, ionotropic, kainate 4
Orthology
K05204  
glutamate receptor, ionotropic kainate 4
Organism
dre  Danio rerio (zebrafish)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    556582 (grik4)
Ion channels [BR:dre04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   556582 (grik4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
15
AA seq 965 aa AA seqDB search
MLAAWAPLLFLAMWVRNATSGPLSFRIAAILDDPMECSRGERLAITLAKDSINRSSNRST
TGKLEVDIFELLRDSEYETGETMCQIMSKGVVAVLGPSASPASNSIISNICGEKEVPYVK
VAPEDILKVQFPRFTTLDLRPTNTDISMAVAGLLTFFNSSTSCLICAQADCLLNLEVLLR
QFLISKETLSVRMLDDSQDPTPLLKEIRDDKTATIIVDANATMSHVILERASELGMLSVY
YTYILTSLEFSLLRLDDLADQRVNIVGFSVFNRTHPFFQDFVLSLNRSWQENCDHAPFAG
TPLSSALLFDAVHTVVAAVQELNRSQNVGATQLSCKSSKIWEHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALRIMQNSRDGLRQIGQWHSEQGLSMERKLPSLNVTDTLFNTTLTI
TTILENPYVMLRANHQELEGNDRYEGFCVDMLKELADILKFKYRIRLVGDGVYGVPGANG
TWTGMVGELISRKADLAVAALTITAEREKVIDFSKPFMTLGISIMYRVHIGRRPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYNPHPCLKGRCSLLINQYSLGNSFWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESVDDLA
DQTAIEYGTMHGGSTMTFFQNSRYQTYQRMWNFMYSKQPSVFVKSTEEGIARVLNSNYAY
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPLGSVYRDEFDLAILRLQEENRLEILK
RKWWDGGKCPKEEDHRAKGLGMENIGGIFVVLVCGLLVAIFMAVLEFVWMLRHTPGTELS
VCEEMLRELQGIVLCQDSLQLRRRRGASVLRPQPLPLDERRARAAAASLSNGKLCTGTGL
SEPLSHRLAQEAALVARGCSHIRICPECRRFQGIRVRPSGPPGASPSHSEESIEWEKGTN
NSEHE
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcagcctgggcgcctctgctcttcttagccatgtgggtgagaaacgccaccagt
ggcccgctctcattcagaatagctgccattcttgatgacccgatggagtgtagccgaggg
gagcgactggccatcactctggccaaagacagcatcaaccgttccagcaatcgctccacc
actggcaaactggaggtggacatctttgagctgctccgagacagtgaatacgagacaggg
gaaacaatgtgccagatcatgtccaagggggtggtggcggtcctgggcccctctgccagc
ccggcatccaactccatcatcagtaatatctgcggagagaaagaggtgccctacgtgaag
gtggctccggaggacatactcaaggtgcagtttcctcgctttaccacgctggacctcagg
cccacgaacacagacatcagcatggctgtagctgggttgctaactttcttcaacagcagc
acatcgtgtctcatatgtgctcaggctgactgcctattaaacctggaggtgttactgcga
cagtttctcatctcgaaggaaaccctttccgttcgcatgctggatgacagccaggatccc
accccgcttctcaaggagatccgtgatgacaagactgctactataatagtggatgccaac
gccaccatgtctcatgttattttggaaagggcctcagagttggggatgctgtcagtctac
tacacctacatcctgacttccttggaattctctttgctacgattggacgatttagctgat
cagcgagtcaacatcgtgggcttttcagtcttcaacaggacacatcctttctttcaggac
tttgtgctcagcctcaatcgatcctggcaggagaactgtgatcacgcaccgtttgcagga
acaccgctgtcatcagcgctgctgtttgatgcggtacatacggtggtggcagccgtgcag
gagctgaaccgcagccagaacgtaggagccactcagctctcctgcaagtcctctaagatc
tgggagcacggcacgagtctgatgaactacctgaggatggtagagttggaaggtctaaca
ggccacatcgagttcaacagcaaaggccagcgttcgaactatgccctgcggatcatgcag
aacagcagggatggcctaaggcagatcggtcaatggcattcagagcagggactgtccatg
gagaggaagcttccttcacttaacgtgacggacacactattcaacaccactctcaccata
actaccattctggagaacccgtatgtaatgttgagagccaatcaccaggagcttgaaggg
aacgatcgctatgagggcttctgtgtggacatgctaaaggagctggcggacatcttgaag
ttcaagtaccgtattcggctagtcggggatggtgtgtatggggtgccgggagctaacggt
acctggacagggatggtgggagagctcatcagcaggaaagctgacttggctgtggccgca
ctgaccatcacggctgagagagagaaagtcatcgatttctccaaacccttcatgactcta
gggatcagcatcatgtacagagttcacataggaagaagaccggggtatttctcctttttg
gatccgttctctcctggggtttggcttttcatgttgctggcgtacctggctgtcagctgc
gtgctctttttggtggcgagactaacaccctacgaatggtacaaccctcacccttgccta
aaggggcgctgcagcctgctcattaaccagtactctctgggcaacagtttctggtttcct
gtaggggggttcatgcagcaaggctccaccatcgccccaagagctctgtccacacggtgt
gtcagtggagtatggtgggcctttaccttgatcatcatctcttcctacacagccaacctg
gcggcctttctcactgtgcagaggatggaggtgcccatcgagtcggtagatgatctggct
gaccagacggccattgaatatggcaccatgcacggcgggtccacaatgaccttcttccag
aactcccgctaccagacataccagcgcatgtggaacttcatgtactccaagcagcccagt
gtgtttgtgaagagcacggaggagggcatagcacgagtgctgaactccaattatgcctac
ctgctagagagcaccatgaacgagtactatcgccaacgcaactgtaacctcacccagatc
ggaggcctgctggacaccaagggctatggcattggcatgcctcttggctctgtctacaga
gatgagtttgatctggctatactcagactccaggaggaaaaccgcctagagatcctgaaa
aggaaatggtgggatggtggcaaatgtccgaaagaggaggatcatcgagcgaaaggtctg
ggcatggagaacatcggtgggatctttgtggtgttagtgtgcggtttgctggtggccatc
ttcatggcagtgctggagtttgtgtggatgctccgtcatacgccaggaacagagctgtcc
gtgtgcgaggagatgcttcgagagctgcagggcatcgtgctgtgccaggacagcctacag
ttacggcgcaggcgtggagccagcgtgttacgaccgcagcctctgcccctggatgaacgg
cgggcgagggcggcagcggcgagtctcagcaacggcaagctgtgcacgggcacgggcctg
tccgaaccgctctcccacagactggcgcaggaggccgccctggtggcgcgaggctgcagt
cacattcgcatctgcccggagtgccggcgctttcagggcattcgcgtacgcccgtccggc
cctccaggagcttcgcccagccacagcgaggagagtatagagtgggagaaaggcaccaac
aacagtgaacacgaataa

DBGET integrated database retrieval system