KEGG   Danio rerio (zebrafish): 556752Help
Entry
556752            CDS       T01004                                 

Gene name
itgb8, si:ch1073-83d9.2
Definition
integrin, beta 8
Orthology
K06591  
integrin beta 8
Organism
dre  Danio rerio (zebrafish)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    556752 (itgb8)
   04514 Cell adhesion molecules (CAMs)
    556752 (itgb8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    556752 (itgb8)
  Cell communication
   04510 Focal adhesion
    556752 (itgb8)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   556752 (itgb8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
19
AA seq 720 aa AA seqDB search
MKRFLDGAHVSQRCGSVSDLRVRGCEEEFIENPKVKVEVNATISSSQVAPREITIHLRPG
SEASFVIEVQQLERYPVDLYYLVDVSASMQDNLDRLKTVGLALSHQMKQHSSDFRVGFGS
FVDKPVSPYIDVHPSKLLNPCSEYEVHCRPAHGFIHVLPVTQNMSEFTRVIQEQRISGNM
DTPEGGFDAMLQATVCQKDIGWRPEAKHLLLVMTDQPSHLALDSKLAGIVVPHDGRCHLE
DNVYSQTSTMEHPTVAQLAEKLLENSIYSIFAVDHLQYQWYEDLVDLIPGSYVGRLFPKA
SNLKDLVVQAYKKLLSDVEVQMELQDPQQAERFWVNVSAICPGGSSAAGNSKCSGVQPKQ
TVFFQLTVGMLSCPAGSADQDVLMLVRPVGFNESVRVRIRQLCGSGCTDPKPEPSSCTTN
ASDSCREHRNTPVCSSRGVCRCGTCVCDSSRFGNIYGKFCEMDDFSCPYDGGLVCGGHGR
CVRGECVCFSGWTGEACACRESTDSCVSDDGFICGDRGRCVCGKCVCDDPRRSGAFCEKC
PMCHSSCQSHWNCVNCHLSNGLGSDGFQLCNQSCSPLVDYVDDITELVRGKYCLYPSTDK
CQYRFLMELASDGAQLHISRHPVCVWSRRYFKTFLSVFLLTVTLGIGMLAGVRQLLRVTG
RSCISKTEPQFEHTHKDSSYVPTSSEKTITYRRDRLPNHPVEMHTHTPTLTHKMPIGDAW
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggtttctggacggggcgcatgtaagccagcgatgcggatctgtgtccgacctg
cgagtcagaggatgtgaagaggaatttatcgagaacccgaaagtgaaagtggaagtaaac
gccaccatcagcagctcacaggtggcaccaagagaaatcaccatccacctacgaccaggc
agcgaggcgagttttgtgatcgaagttcagcagttggaacgatacccagtggatctgtac
tatcttgtggacgtctcggcctccatgcaggacaacctggatcggctgaagacggtgggt
ttggctctgtctcatcagatgaagcagcactccagtgacttcagagtgggcttcggctct
ttcgtggataaaccagtgtctccatacatcgacgtgcacccttctaaactactcaacccc
tgcagtgaatacgaggttcactgcagaccggctcacggcttcatccacgtcctccccgtc
acccagaacatgagcgagttcactagagtgatccaggagcagaggatctcaggaaacatg
gacacaccggagggaggcttcgatgccatgctgcaggccaccgtctgccagaaggacatc
ggctggcgtccagaagccaagcatctgctactggttatgacggatcagccttcacatctg
gctctggacagtaaactggctggtatcgtggttcctcatgacggccgctgccacctagag
gacaacgtctactctcagaccagcactatggaacacccgacagtcgctcagttggcggag
aagcttctggaaaacagtatttactccatcttcgctgtggatcatctgcaatatcagtgg
tatgaggatttagtggatctgattcctggaagttacgtgggtcgactgtttcccaaagca
tctaatctgaaagatctagtagtgcaggcctacaagaagctgctgtcggatgtggaggtg
cagatggagctgcaggacccccagcaggctgagcgtttctgggtgaacgtcagcgcgatc
tgccctggaggatcctccgctgccggaaacagcaaatgctccggcgttcagcccaaacaa
acagtgttctttcagctgacagtaggcatgctctcgtgtccagctgggtcagcagatcag
gatgtgttgatgcttgtgcggccggtgggcttcaatgagtctgtgcgtgtgcgtattcgt
cagctctgcggttccggctgcactgatcccaaacccgaaccctcgtcctgcactacaaac
gctagtgactcctgcagagagcacagaaacacccctgtctgcagttctagaggcgtctgc
cgctgcgggacgtgtgtgtgcgactccagcagatttgggaacatctacgggaagttctgt
gagatggatgatttctcctgtccgtatgatggaggcctggtgtgtggaggtcatggccgg
tgtgtcagaggtgaatgtgtgtgtttctctggctggacgggtgaagcctgcgcctgtcgt
gagtccacagacagctgtgtgtctgatgacggtttcatctgcggcgatcggggaaggtgt
gtgtgtggaaagtgtgtgtgtgacgatccgcggcgatccggagccttctgtgagaaatgt
cccatgtgccacagctcctgtcaatcacactggaactgtgtgaactgtcatctgtcgaat
ggactcggatctgatggttttcagctctgtaatcaaagctgctctccattggtggactat
gttgatgacatcacagagctggtccgggggaaatactgcctgtatcccagcactgataag
tgtcagtatcgctttctcatggaattggcatcagatggagctcagctgcacattagtcga
catcctgtgtgtgtttggagccggcggtactttaagacctttctcagcgtcttcctgctg
accgtcacactgggcatcgggatgttggccggcgtccggcagctgctgagagttacaggc
cgctcctgcatctccaagactgagccgcagttcgagcacacacacaaggactcgtcttac
gtcccaacgagcagtgagaagaccataacatacaggagggaccgtctgcccaatcacccg
gtggagatgcacacacacacacccacacttacacacaagatgcccatcggggacgcctgg
tag

DBGET integrated database retrieval system