KEGG   Danio rerio (zebrafish): 556823Help
Entry
556823            CDS       T01004                                 

Gene name
cylda, cyld
Definition
cylindromatosis (turban tumor syndrome), a
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    556823 (cylda)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     556823 (cylda)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C67
   556823 (cylda)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
7
AA seq 912 aa AA seqDB search
MSSTLWSQEKPGGSFRDDWRFYIVVKECTVERPGQKTLRIPRGSLGQACQERNSLGRTIP
ASKGKRSLRILDQTNVVVSVDERDVMELEEKLAELLFPITNCEERYSLLCNRSRLDRARD
INCGSKVRVQLRSGDEPLPGVVRFKGALLPDRALSGIWFGVELLEEGRGQGFTEGSYQGQ
QLFRCEDECGVFVALDKLELWEDEELEVDRVTLEDNDPEEEGEAPPLEINSRVLVQTREG
PERGTVIFCDLLPGNESLGYYVGVDMDNPIGDWDGIIDGKQLCNFASLEHTRLVPICDVM
PEYSMQDQRLPKVFACRGGNDKPVSQSKPKSKVGEDPAKSLTDMPPDFNPSSSPSRAPPT
TTSLSNDNKFHSLPFSLSRKVGPNGSMSHGPLSLSAGSVMGEQPELLPAATPLQRASSPP
QGQPGLEVGSMVEVKENPPLCGVIRWVGLPPGLQESLAGLELEEECVGCTDGTFKGIRYF
TCPPKKALFVKLKCCRPDSRFPSLHHSPNPIERCNSIAFGGYLSEVVNENTPPRTENDGL
EVMVGKKKGIQGHYNSCYLDSTLFCLFSFSSVLDTVLLRPRSKTDVEYYKETQELLRTEI
VNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLRLRS
AGQKVQDCYFYQIFMDKKDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFK
MFNKIFPSLELDITDLLDDTPRECRICGGLALYECRECYEDYDITPGKIKQFCEKCNTQV
HLHPRRKIHRYVKLSVPKELHESVWRQGSYPHQQMELFAVLCIETSHYVAFVKYGSADSA
WLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYM
CMYQSPTMSLYK
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgagctctacgctatggagccaggagaagccagggggcagtttccgggacgattggcgt
ttctacattgtggtgaaggaatgcacggtggaaaggccaggccagaagactctgcgcatc
ccacggggcagcctaggtcaggcctgccaggagcgcaacagcctcggacgcacaatccca
gccagcaaaggtaaacgtagcctacgcatcctggaccagaccaatgtagtggtgagcgtg
gatgaacgggatgtgatggagctcgaggagaagctggcggagctactgttccctatcacc
aactgtgaagagcgttacagcctgctgtgtaacaggtcgcgtctggacagggcccgcgac
atcaactgtgggtcaaaagttcgagtgcagcttaggtcaggcgatgaacctcttccaggc
gttgtccgctttaaaggagctttgctgcctgatcgggcactgagtgggatctggtttggt
gtcgaactgctggaggagggtcggggtcaaggtttcacggagggctcttatcagggtcag
cagctgtttcgttgtgaagatgaatgtggggtctttgttgcactggataaacttgagctc
tgggaagatgaggagttggaggtggatcgtgtgacgctggaggataatgacccggaagag
gaaggtgaagcaccgccactggagatcaactctcgagtcttggtacagactcgggaagga
ccagaaaggggcactgtaattttctgtgacctactgcctggcaatgaaagtctgggatac
tacgttggcgttgatatggacaatcccattggagactgggatgggatcatcgacggcaaa
cagctctgtaattttgctagtctcgaacacacccgtctcgtccccatctgtgatgtgatg
ccagaatactccatgcaggatcagaggctgcccaaagtctttgcctgcaggggtggcaat
gacaaacctgtcagccagagcaaaccaaagagcaaagtcggcgaagacccagccaaatcc
ctgacagacatgccgccagacttcaacccaagctcatctccatctcgagctccgcctacc
accacctcgctgtccaatgacaacaagttccactcgctgccgttcagcttgagccgaaaa
gttggccccaatggcagcatgagccatgggcccctttccctatccgccggctcagtgatg
ggggagcagccggagctcctgcctgctgctacacctctgcagagggcttcatcaccacca
caaggccagccaggtttagaggtcgggtcaatggtggaggtcaaagagaacccaccgctg
tgtggggtcatccggtgggttggtctccctccaggactacaagagtcactagctggacta
gagctggaggaggagtgtgtgggctgcactgatggtacatttaaagggattcgttatttc
acgtgtccaccaaagaaagctctgtttgtcaaactgaagtgctgcaggcctgactcacgg
tttccttccttacatcattcacctaaccccatagagcgatgcaactctatagcttttggg
ggttacctgagtgaagtggtgaatgaaaacactcctccgcggacagagaatgatggtttg
gaggtgatggtggggaagaagaaaggaattcaaggacattataactcctgctatctggac
tctacattgttctgtcttttctcctttagttctgtgttggatacggttctcctgaggccc
agatccaagactgatgtagaatattacaaagagacccaagagttattgcgcacagaaata
gtcaatccactacgaatacatggttacgtgtgtgccaccaaaatcatgaaacttcggagg
atactggagaaagtggaggcggcgtctggattcacttcagaggaaaaggatccagaggag
ttcctcaacatcctgtttcatcacatcctgagagttgatcctcttctcagacttcggtct
gcagggcagaaggttcaggactgttacttctatcaaatctttatggataagaaagataaa
gtgatggtgccgaccagccagcagcttctggagtggtcttttatcaacagtgatctcaaa
tttgcagaggccccttcttgccttatcattcagatgcctcggtttgggaaggacttcaaa
atgtttaataagatcttcccatctctggagcttgacatcacagatctattagacgacacc
cctagagaatgtcgaatctgtggaggtttagctctatatgagtgcagagagtgctatgaa
gattatgacatcacaccaggaaagatcaagcagttctgtgaaaagtgcaatacgcaggta
catctgcacccacggcgtaagattcatcggtatgtgaagttatcagtccctaaagagctg
cacgagtcagtatggaggcagggttcttaccctcaccagcagatggagctgttcgctgtg
ctttgcattgagaccagccactatgtcgcctttgtcaaatatggatccgcagactcggcc
tggctgttctttgatagcatggctgaccgcgacggtggtcagaatggatttaacatccca
caggtgtcgcggtgtccagaagtcggggaatacctgaaaatgactcctgaagaactccac
gcgctggacccaaaaaacatccagggctatgcacgcagacttctctgtgacgcttacatg
tgcatgtaccagagtcccaccatgagcctctataagtag

DBGET integrated database retrieval system