KEGG   Danio rerio (zebrafish): 557063Help
Entry
557063            CDS       T01004                                 

Gene name
rasgrp2, si:ch211-247j24.2
Definition
RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Orthology
K12361  
RAS guanyl-releasing protein 2
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    557063 (rasgrp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Position
21
AA seq 592 aa AA seqDB search
MESVSWDQPASVVELVEACIKAFDNEGVLKDPSLVRMFLTMHPWYLSSSDLAKKLLQKSQ
QQDCSANRQSQICHLVKYWISEFPAEFDLNPALAEQIRGLKERLEQNGDVRRSLLIDIDS
IPSYEWRRQLDETVQKKRKTSLLFDHLDASTLAEHLTYMEYKSFCKILFQDYHSFVMHGC
TVDNPILERFITLFNSVSQWIQIMVLSKPTAQQRATVISEFIKVAERLLQLQNFNTLMAV
VGGLSNSSIARLKNTQALISSDTRKVFDGLVELVTSFGNYSRYRQRFSECSGFRFPILGV
HLKDLIAVHVALPDWIDPEKTRVNLTKTYQLYAILEELALIQSTPPNIEANTDLLNLLIV
SLDQYHSEDDIYQLSLQREPRSIKLSTSSSKSQSPLIEQWASSVKPKADPSIINKHIEKM
VESVFQNYDTDGDGYISQEEFEIIRSNFPYLGKFDELDQNQDCKISREEMIEYFTKASSL
QNCKMGFVHTFAETSSIKPSFCRHCSRLIWGFYNQRCKCKVCGVSCHKDCVSRLAIECRK
RTQSVSVYNDVSSKATRSFSFPPPQSTETIAESPVICTDPLQDQDEVFDVYL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggagagcgtttcgtgggatcagccggctagtgtggtggagctggtggaggcttgtatc
aaagctttcgacaatgaaggtgtcctaaaggatccttctctcgtacgaatgtttctcacc
atgcatccctggtacctttcatccagtgacctggccaagaagctccttcaaaagtctcag
caacaggattgttctgcaaatcgccagtcgcagatttgtcaccttgtcaagtactggata
tcagagtttccagccgagtttgacctgaacccggcgctggctgagcagatccgcggtttg
aaggagcgactggagcaaaatggagacgtgaggcgcagtttgctcatcgacattgacagc
atcccatcatatgaatggcggcgtcagctggatgaaactgtccagaaaaagcgcaagacc
tctcttctattcgaccacctagatgcctccacccttgccgaacacctcacatacatggaa
tacaaatcattctgcaaaattctgtttcaggactaccacagtttcgtgatgcacggctgc
acggtggataatcccattctggagcgtttcattactctgttcaacagtgtttcgcagtgg
atccagatcatggtcctcagtaaacccacagcccagcagagagcaaccgtcatcagtgaa
ttcatcaaagtggctgagagactgctgcagctgcagaactttaacacactgatggctgta
gttggaggcctcagcaacagctccatcgctcgactcaagaacacacaagctctcatcagc
agcgacacacgcaaggtgtttgatggattggtggagctggtcacttcctttggaaactac
agccgctatcgtcagcgtttctctgaatgttcaggattccgcttccccatccttggggtt
catctgaaggacctgattgccgtccatgtggctctgcctgattggatcgacccagaaaag
accagggtcaacctaaccaagacctatcaactatacgccatcctggaggagctggcactc
attcaaagcactccccccaacatagaggccaacacagacctgctcaatctacttatagtg
tctttggaccagtaccactcagaggatgatatataccagctgtctctacagagggagcct
cgcagtattaaactctcgacctccagctcaaagtcacagtctcctctaatagaacagtgg
gcatcttcagtcaaacccaaagcggatccatccattatcaacaagcacatcgagaaaatg
gtggagtcagttttccaaaactatgacaccgatggcgatggctacatttcccaagaggag
ttcgagatcatcaggagcaatttcccctacctcggcaagtttgacgaactggaccaaaac
caggattgtaaaattagccgagaggagatgattgagtacttcaccaaggcgagctcttta
cagaactgtaagatgggttttgttcacacgtttgcagagacgagcagcatcaagccttca
ttttgtcgccactgctctcgcttgatatggggattttacaatcagcgatgcaaatgcaaa
gtgtgtggagtgagctgtcataaagactgtgtgagtcgtttggccattgagtgccgtaag
agaacgcagagtgtcagtgtttataatgatgtgtcctcaaaggccacacgctccttcagc
tttccacctccacagagcactgagaccatagcagagagcccagtgatctgcacagaccct
ttgcaggatcaggatgaggtttttgatgtctacctttga

DBGET integrated database retrieval system