KEGG   Danio rerio (zebrafish): 557186Help
Entry
557186            CDS       T01004                                 

Gene name
aldh18a1, cb842, cb899, pycs, sb:cb881, wu:fa91f10, wu:fi05f11, wu:fi17d12
Definition
aldehyde dehydrogenase 18 family, member A1
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dre01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dre00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
12
AA seq 782 aa AA seqDB search
MSLQRMFSCSRLLARPNALQTFRRAASQGKMPLARAHGKSFAHRSELRQAKRIVVKLGSA
VVTRGDECGLALGRLASIVEQVAMLQNQGREMMIVTSGAVAFGKQRLRHEILLSQSVRQA
LHSGQNQLKDMSLPVLEARACAAAGQSGLMALYEAMFTQYSTCTAQILVTNLDFHDEQKR
RNLNSTLYELLRMNIVPIINTNDAVVPPPEPNSDLQGVNVISIKDNDSLAARLAVEMRAD
LLIALSDVEGLYDSPPGSDDAKLLDTFYPGDQQSITYGTKSRVGIGGMEAKVKAALWALQ
GGTSVVIANGTHPKVTGHVITDIVEGKKVGTFFSEVKPAGPTVEQQTEMARSAGRTLASL
EPEQRSDIICALADLLTERKEEILSANKKDMENAVNTGRLSPAMLKRLSLSSSKLNSLSI
GLRQIAVSSQDSVGRVLRRTRVANNLELEQITVPIGVLLVIFESRPDCLPQVSALAIASG
NALLLKGGKEAANTNRILHELAQEALSIHGVKDAIQLVSTREEVEDLCRLEKMIDLIIPR
GSSQLVRDIQRAAKGIPVLGHSEGICHVYVDHEASIDKAIKIIRDSKCDYPAACNAMETL
LVHRDLLRTPVFDQIIDMLRTEQVKIHAGPKFASYLTFSPSEVKSLRTEYGDLECCIEVV
DSMQEAIDHIHKYGSSHTDVIVTENENTAEQFLQQLDSACVFWNASSRFADGYRFGLGAE
VGISTARIHARGPVGLEGLLTTKWVLRGEGHTVADFSEHGSMTYLHENLPVAQLLPGYRT
TS
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgtctctccagaggatgttctcctgttcgcggcttttagcaagaccaaatgctctgcaa
acattcaggcgagcagcttcacaaggcaaaatgccgctggcacgggcgcatggtaagtca
ttcgctcaccggagcgagctgcgccaggccaagagaatcgtcgtcaagttgggaagtgct
gtcgtaacccgaggtgatgagtgtggcctcgctttgggccgactcgcttcaatcgtagag
caggtggccatgcttcagaatcagggtagggaaatgatgatcgtgaccagtggcgctgtg
gcatttggaaaacaaaggctgaggcatgaaatacttctctcacagagtgtcagacaagcc
ctgcattcaggccagaatcagctcaaagacatgtcattgccggttctagaggcgagagct
tgtgccgctgcaggacagagtggccttatggctctgtatgaggcaatgttcactcagtac
agcacttgcacggcccagatcctggtaacaaacctagacttccacgacgaacagaaaaga
cgaaacttgaatagcactctgtacgagctgctgcgaatgaacatcgttcccatcatcaac
accaacgatgccgtggtgcctcccccagaacccaacagcgacctacagggggtaaatgtt
atcagcattaaggataatgacagtcttgctgcaaggcttgctgtggaaatgagggcagat
ctccttattgctctctctgatgtagagggcctttatgacagtccaccagggtcagatgat
gccaagcttttggacacattttaccctggagaccagcaatcaataacctatggcacaaag
tctagggtcggcatcggaggaatggaagccaaggtaaaagctgctctctgggctctccaa
ggaggaacgtctgtggtcattgctaacggtacacaccccaaagtcacaggtcatgtgatc
actgatattgttgagggcaagaaagtgggaaccttcttctcagaggtcaagccagcaggc
cccacggtggagcagcagacagaaatggctcgctctgctggcaggactcttgcttccctt
gaaccagagcagagaagtgacatcatctgtgcattggctgaccttctcacagagaggaaa
gaagaaatcctgtctgccaacaagaaggacatggagaacgctgtcaacacgggtcgcctg
tctccagctatgctgaagcggcttagtttgtcatcgtctaagctgaacagtctgtccatc
ggtctgcgtcagatcgcggtgtcctctcaggacagtgttggcagggttttgcgcaggact
cgtgttgcaaacaacctggagctggagcagatcactgtgcccataggagtactgctggtc
atctttgagtcacggccagactgcctgcctcaggtttctgcattagccattgccagtgga
aatgctcttttgctgaaaggtggcaaagaggcggccaacaccaatcgcatcctgcatgag
cttgcacaggaagccctgtctatacatggagtcaaagatgccatccaactggtgagcact
cgtgaagaggtggaggatctgtgtcgtctggagaagatgattgatctgatcattccccgt
ggctcctcgcagctggtcagagatattcagcgagcagctaaaggcatccctgtgcttggc
cacagtgaggggatctgccatgtctatgttgaccacgaggccagtattgacaaagccatc
aaaatcatccgagactctaaatgtgactaccctgctgcctgcaacgcaatggaaactctg
ttggtgcatcgagatcttctcagaactccagtatttgatcaaatcattgatatgctgaga
acagaacaagtcaagattcacgctggccctaagtttgcatcctatctaacctttagtcca
tcagaagtgaagtctttgcgtacagagtatggagatctggagtgctgtatcgaggtggtg
gacagcatgcaggaggctatagatcacatccataaatatggcagctcacacactgatgtt
atcgtcactgagaacgagaacacagctgagcagttcctccagcagttggacagtgcctgt
gtcttctggaatgccagctcacggtttgctgatggatatcggtttggcctaggtgcggag
gttggcatcagcactgcccgtattcatgcccgtggtcctgtggggctggaagggcttctc
acgactaagtgggtgttgcggggtgaaggccacacagtggcagatttctcggagcatggc
agcatgacgtatctgcatgaaaatctaccggtggcacagctccttcctggatacagaacc
accagctag

DBGET integrated database retrieval system