KEGG   Danio rerio (zebrafish): 557259Help
Entry
557259            CDS       T01004                                 

Definition
alpha-1A adrenergic receptor
Orthology
K04135  
adrenergic receptor alpha-1A
Organism
dre  Danio rerio (zebrafish)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    557259
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    557259
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    557259
   04270 Vascular smooth muscle contraction
    557259
G protein-coupled receptors [BR:dre04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    557259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 431 aa AA seqDB search
MTSMLPEEDYINSTFFPENCSNCSTIPVLEIDVTKTLVLGLVLVLFLIFGVMGNILVILS
VACHRNLRSVTHYFIGNLAIADLLLSSVVLPFSAVSEALGRWVFGRHLCNAWTALDVLCC
TASILSLCVISVDRCMAVSYPLQYPSFATGRRAMTAVAALWALSAAISVGPLFGWREPMP
EDESVCRVNEDPGYAIFSAACSFYVPLAVILAMYCRVYVVARHKTRAMSKSRETNGLSEQ
GMTLRIHCRKAQNDTRKEDAMRLKNSHFAFMRLLKFSREKKAAKTLGIVVGCFVLCWLPF
FLVLPISSIFPSHRPPDAVFKITFWLGYFNSCLNPIIYPCFSQEFKKAFQNVLHGRCLSR
THQTWSPPANATQYMPKSPQGLSSGFTDSWRSDHASSSAVMLNENSYDEPDTSLSLKVHQ
VSICKIDGEPV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcatgcttccagaagaagattacataaattcaaccttctttcccgaaaactgt
tccaactgttccaccatacctgtgttggagatcgacgtcaccaagactctggttttgggt
ctggttctggtcctttttttaatattcggagtgatgggtaacatcctggtcatcctctca
gtggcatgccatcgcaaccttcgatccgtgactcattattttattggaaatctggcaatc
gcagacctgcttctgagctctgtggttcttccattctctgctgtatctgaagccttgggt
cgctgggtgttcggtcgtcatttatgtaacgcctggaccgctcttgacgtgttgtgctgc
acggcatccatcctcagcctctgcgtaatctctgtggatcgctgcatggccgtcagttac
ccgctgcaatacccttcctttgctacgggtcgaagggcaatgactgcagtggcagctctc
tgggccctttcagctgctatctccgtcgggccactatttggatggagggaacccatgcca
gaagacgagtcggtgtgcagagttaacgaagatccaggatacgccatcttctctgctgca
tgctccttctatgttccgttggcagtcattctggcaatgtactgtagggtgtatgtagtg
gcccgacacaagactcgtgcaatgagtaagagcagggagacgaatgggttaagtgagcag
ggaatgactctacgtatccactgtcgaaaagcccagaatgacaccaggaaggaggatgca
atgcgcttgaagaactcgcactttgcctttatgcgcctacttaagttctcacgggagaag
aaggcggccaagactcttgggattgtggtgggatgtttcgtgctctgctggctgccgttt
tttcttgtgctgcccattagctccatcttcccatcccacagaccccccgatgctgttttc
aaaatcacattctggctcggctacttcaacagctgcctgaaccccatcatctacccatgc
ttcagccaggagtttaagaaagccttccagaacgttctgcatggacgctgcctgagccga
acacatcagacttggagccctccagccaatgcgactcagtatatgcccaaatctccacag
ggtttatcatctggatttactgactcctggaggtctgatcatgcatcatcgagtgctgta
atgctgaatgaaaactcatatgatgaacctgacacatctctgagtctcaaggttcatcag
gtttccatatgtaagatagatggtgagcctgtgtga

DBGET integrated database retrieval system