KEGG   Danio rerio (zebrafish): 557526Help
Entry
557526            CDS       T01004                                 

Gene name
traf2b
Definition
(RefSeq) TNF receptor-associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04141  Protein processing in endoplasmic reticulum
dre04210  Apoptosis
dre04217  Necroptosis
dre04621  NOD-like receptor signaling pathway
dre04622  RIG-I-like receptor signaling pathway
dre04920  Adipocytokine signaling pathway
dre05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    557526 (traf2b)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    557526 (traf2b)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    557526 (traf2b)
   04217 Necroptosis
    557526 (traf2b)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    557526 (traf2b)
   04622 RIG-I-like receptor signaling pathway
    557526 (traf2b)
  Endocrine system
   04920 Adipocytokine signaling pathway
    557526 (traf2b)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    557526 (traf2b)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     557526 (traf2b)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     557526 (traf2b)
Ubiquitin system [BR:dre04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    557526 (traf2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 Paramyxo_NS_C zf-C3HC4_2 zf-C3HC4_3 zf-C3HC4_4 zf-RING_6 Tropomyosin_1
Motif
Other DBs
NCBI-GeneID: 557526
NCBI-ProteinID: XP_005165556
ZFIN: ZDB-GENE-030131-5345
Ensembl: ENSDARG00000101036
Vega: OTTDARG00000018454
UniProt: A0A0R4ILY5
Position
5
AA seq 532 aa AA seqDB search
MISAAGTLCKWKDMERPSLPSSLDSTLPGISREVLSVSMEPKYQCQQCKDILRKPFQAQC
GHRFCVFCFKQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPN
EGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKVT
FNFKEIKAHDEICQKFPMQCKDCGKKKIPREKFQEHTKSCAKSKSACQFREIGCRAVVDN
CKQQEHEQTSIMEHLRLMLALLSSMRLRAEGAGEWQEDVGLGLYRGPEDAPPAGAHNVGR
GGGPGVQKKVTTLENIVCVLNKEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTLT
TRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYK
MCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRP
DVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVDLTGL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcgctgcaggcactctgtgtaaatggaaggatatggaacgtccatctttacca
tcttctctggactcaacattgcctgggatatctcgagaagtgctgtcggtgtccatggaa
ccgaaatatcaatgccagcagtgcaaagatattcttaggaaacctttccaagcacaatgt
ggacatcgcttctgtgtgttctgtttcaaacaactgaccagctcagggcccataccctgc
gaagcctgtcgtgctgagggtatatttgaagaggaaacgtctgtgcttaatattgcagtg
gcatttcctgataatgcagcacgaagagaaattgatagcttgcctgctaaatgcccaaat
gaaggttgtagttggtctgggacactgaaggactttgagaatcaacatgaaggtcgctgt
gcctttgaacgtgtgaaatgtgaagcatgtcaagtgcttatattgctctctgagaaggac
cgtcacaatgagcgggaatgtgaagccagaaccctcaactgtaaatactgcaaagtcaca
ttcaactttaaggaaattaaggcccatgatgaaatttgtcagaaatttcccatgcaatgc
aaagactgtggtaaaaagaaaatacccagagagaagtttcaagagcacaccaaatcttgt
gcaaaatctaagtcagcatgccagttcagagagattggttgcagggcagtggttgacaat
tgcaagcaacaggagcatgagcagaccagcataatggagcatttgcgtctgatgttagct
ttgctatcctccatgcgcctgcgagcagaaggggctggagagtggcaggaagacgttggg
ctgggattgtatcgcggacctgaagatgcaccaccagcaggagctcataatgtaggaaga
ggaggcggtcctggtgttcagaaaaaagtcacaactttggagaacatagtgtgtgtcttg
aataaagaggtggaacgctctgccctcaccatggaggcgatatcccggcaacatcgcctg
gaccaggaaaaaattgagaatttgtcaaacaaggtgcgacagttggaacggacgttaacc
acgcgagatctgcagttagcagaatctgagcagtctttgcgggagctgcagttttgtaca
tatgatggggttttcatttggaaaattgcagaattctctcgacgcaggcaagacgcagtg
gcaggccgagcacctgccatgttctcacctgcattttactccagtaaatatgggtataag
atgtgtctgagactgtacctgaacggtgatggcacaggtcgaggctctcatctctctctg
ttctttgtggtcatgaaaggcaaatatgatgctctgctgaagtggcccttcagccagaag
gtgacattgatgctgttggaccaaaataacagagagcacatcattgatgccttcaggcct
gacgtgagctccacatctttccagagacccatcagtgagatgaatatagccagtggctgt
cctctcttctgccccctcgccaagctggcaggcaaaagctcatatctgagagacgacacc
atatttattaaagccatagtcgaccttactggcttataa

DBGET integrated database retrieval system