KEGG   Danio rerio (zebrafish): 557526Help
Entry
557526            CDS       T01004                                 

Gene name
traf2b, fd14c07, si:dkey-170o10.1, wu:fd14c07
Definition
Tnf receptor-associated factor 2b
Orthology
K03173  
TNF receptor-associated factor 2
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
RIG-I-like receptor signaling pathway
Adipocytokine signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    557526 (traf2b)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    557526 (traf2b)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    557526 (traf2b)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    557526 (traf2b)
  Endocrine system
   04920 Adipocytokine signaling pathway
    557526 (traf2b)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    557526 (traf2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 532 aa AA seqDB search
MISAAGTLCKWKDMERPSLPSSLDSTLPGISREVLSVSMEPKYQCQQCKDILRKPFQAQC
GHRFCVFCFKQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPN
EGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKVT
FNFKEIKAHDEICQKFPMQCKDCGKKKIPREKFQEHTKSCAKSKSACQFREIGCRAVVDN
CKQQEHEQTSIMEHLRLMLALLSSMRLRAEGAGEWQEDVGLGLYRGPEDAPPAGAHNVGR
GGGPGVQKKVTTLENIVCVLNKEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTLT
TRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYK
MCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRP
DVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVDLTGL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcgctgcaggcactctgtgtaaatggaaggatatggaacgtccatctttacca
tcttctctggactcaacattgcctgggatatctcgagaagtgctgtcggtgtccatggaa
ccgaaatatcaatgccagcagtgcaaagatattcttaggaaacctttccaagcacaatgt
ggacatcgcttctgtgtgttctgtttcaaacaactgaccagctcagggcccataccctgc
gaagcctgtcgtgctgagggtatatttgaagaggaaacgtctgtgcttaatattgcagtg
gcatttcctgataatgcagcacgaagagaaattgatagcttgcctgctaaatgcccaaat
gaaggttgtagttggtctgggacactgaaggactttgagaatcaacatgaaggtcgctgt
gcctttgaacgtgtgaaatgtgaagcatgtcaagtgcttatattgctctctgagaaggac
cgtcacaatgagcgggaatgtgaagccagaaccctcaactgtaaatactgcaaagtcaca
ttcaactttaaggaaattaaggcccatgatgaaatttgtcagaaatttcccatgcaatgc
aaagactgtggtaaaaagaaaatacccagagagaagtttcaagagcacaccaaatcttgt
gcaaaatctaagtcagcatgccagttcagagagattggttgcagggcagtggttgacaat
tgcaagcaacaggagcatgagcagaccagcataatggagcatttgcgtctgatgttagct
ttgctatcctccatgcgcctgcgagcagaaggggctggagagtggcaggaagacgttggg
ctgggattgtatcgcggacctgaagatgcaccaccagcaggagctcataatgtaggaaga
ggaggcggtcctggtgttcagaaaaaagtcacaactttggagaacatagtgtgtgtcttg
aataaagaggtggaacgctctgccctcaccatggaggcgatatcccggcaacatcgcctg
gaccaggaaaaaattgagaatttgtcaaacaaggtgcgacagttggaacggacgttaacc
acgcgagatctgcagttagcagaatctgagcagtctttgcgggagctgcagttttgtaca
tatgatggggttttcatttggaaaattgcagaattctctcgacgcaggcaagacgcagtg
gcaggccgagcacctgccatgttctcacctgcattttactccagtaaatatgggtataag
atgtgtctgagactgtacctgaacggtgatggcacaggtcgaggctctcatctctctctg
ttctttgtggtcatgaaaggcaaatatgatgctctgctgaagtggcccttcagccagaag
gtgacattgatgctgttggaccaaaataacagagagcacatcattgatgccttcaggcct
gacgtgagctccacatctttccagagacccatcagtgagatgaatatagccagtggctgt
cctctcttctgccccctcgccaagctggcaggcaaaagctcatatctgagagacgacacc
atatttattaaagccatagtcgaccttactggcttataa

DBGET integrated database retrieval system