KEGG   Danio rerio (zebrafish): 557602Help
Entry
557602            CDS       T01004                                 

Gene name
dyrk2, fc18c09, si:ch211-266a5.8, wu:fa09g03, wu:fc18c09
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     557602 (dyrk2)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   557602 (dyrk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
4
AA seq 587 aa AA seqDB search
MLTKKPCAAAAAYPTGKGGDICQQSSPGLGIGGPRAGAGTETTSPVTLPPLRNSNSLTAG
GNKYTMNDHLHVGNHQQIHVQQLFEENSNKRTVLTSQPNGLTPVGRAGLAMPEKQQEISQ
CRQGSSTSIKSTESKPKPAPLTPEQAMKQYMSKLSVFEHQEILSYTEIYFIGPNAKKRQG
VVGGSNNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKNHQHVALKMV
RNEKRFHRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIK
KNKFQGFSLPLVRKFAHSILQCLESLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSC
YEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLAC
VIEMLGMPSEKLLESSKRAKNFISSKGHPRYCTVTTLPDASVVLNGGRSRRGKLRGPPGS
RDWVTALKGCDDPLFLDFLKQCLEWDPSQRMTPSQALRHPWLRRRLPKPPTEKTTVKRIT
EGTGAITSISKLPPPSGSATKLRTNLAQMTDANGNIQQRTVLPKLVS
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgttaactaagaaaccctgcgctgcggctgctgcctacccgactggcaaagggggtgat
atttgccagcagtcttcccccggactgggcatcgggggtccccgtgctggagcaggcacc
gaaaccacatcacccgtcacattaccaccactcaggaacagcaactctctcacggctgga
ggcaataagtacacaatgaatgaccatctgcatgttgggaatcaccagcagatccacgtt
caacaactgtttgaggagaacagcaacaaacgaacagtgttaacttcgcagcccaatggc
ttgacacctgtaggtagagcaggtctagccatgccggagaagcagcaagaaatcagccag
tgtcgacaaggcagctcaacttctatcaaatcaactgaaagcaaacctaagccagcacct
ttgactcctgagcaggccatgaaacagtacatgtctaagctttcagtatttgaacaccaa
gagatcctcagctacactgagatctattttataggtccaaatgcaaagaaaagacaaggt
gtagttggggggtcaaacaacggaggttatgatgatgatcagggctcctacattcatgtg
cctcatgaccatatagcatataggtatgaggtactaaaagttattggtaaaggcagtttt
ggccaagtggtaaaagcctatgaccacaagaaccatcagcatgtggctctgaaaatggtg
cgtaacgaaaagcgtttccatcgccaagcagctgaggaaattcggattctggaacactta
cgcaagcaggataaggactccaccatgaatgtcattcacatgctggagaactttacattc
cgcaaccatatttgcatgacgtttgagttgctcagcatgaacctctatgagctcatcaag
aaaaacaagtttcaggggtttagtttgccactagtgcgcaagtttgcacactctatattg
cagtgtttggaatccttgcacaagaacagaatcattcactgcgatctcaagcctgagaat
atccttctgaagcagcagggtcgaagtgggataaaagtgattgactttggctccagctgc
tatgagcatcaacgggtctacacttacatccagtcacgcttttacagggccccagaggtc
attctgggtgctagatacgggatgccaattgatatgtggagcttaggttgtatcttagcg
gaattacttacagggtaccctctgttgcctggagaagatgaaggggaccaactagcatgt
gtcatagagatgctaggtatgccctctgagaagttactggaatcatccaagagagccaaa
aatttcatcagttctaagggacatccccgttactgcacagtcacaaccttacctgatgcc
tctgtggtgctgaatgggggaaggtcacgtaggggcaaactcagaggtccaccaggcagc
agggactgggtgacagcactaaagggctgtgatgaccctctcttcttggacttcctcaaa
cagtgtctagagtgggacccgtcccagcgtatgacccctagtcaggcccttcgccacccg
tggctcagaagacgcttgccaaaacctcccacggagaaaacaactgtaaagcggatcact
gagggtactggtgctataacttcaatctccaaattacctcccccttctggctcagccaca
aaattaaggactaacctggcacaaatgactgatgccaatgggaatatacaacaaaggaca
gtgttgccaaaattagtcagctga

DBGET integrated database retrieval system