KEGG   Danio rerio (zebrafish): 557810Help
Entry
557810            CDS       T01004                                 

Gene name
mapk12b, si:dkey-14d8.5
Definition
mitogen-activated protein kinase 12b (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Salmonella infection
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    557810 (mapk12b)
   04370 VEGF signaling pathway
    557810 (mapk12b)
   04068 FoxO signaling pathway
    557810 (mapk12b)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    557810 (mapk12b)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    557810 (mapk12b)
   04621 NOD-like receptor signaling pathway
    557810 (mapk12b)
   04622 RIG-I-like receptor signaling pathway
    557810 (mapk12b)
  Endocrine system
   04912 GnRH signaling pathway
    557810 (mapk12b)
   04914 Progesterone-mediated oocyte maturation
    557810 (mapk12b)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    557810 (mapk12b)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    557810 (mapk12b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     557810 (mapk12b)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   557810 (mapk12b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
4
AA seq 364 aa AA seqDB search
MSLRSRAGFYRQEINRTVWDVPERYRDLIQIGTGAYGTVCSAIDRKTGVRVAIKKLHRPF
QSRLFAKRAYRELRLLKHMKHENVIGLLDVFTSEILLDRFHDFYLVMPFMGTDLGKLMKM
ERLCEDRVQFLVYQILRGLKYIHSAGIIHRDLKPGNLAVNQNCELKILDFGLARQADSEM
TGYVVTRWYRAPEVILNWMHYSQTVDIWSVGCIMAEMLLGRTLFKGNDHLDQLREIMKIT
GTPAPDFITKLQSQDAKNYIRGLPKVPKKDLNTIFFKASSEAVSALELMLVLDPDKRVSA
AEALELPLFTEFREPEEETEALPYDHSMDNTELPLDQWKRHTFTEILSFQPPVTEIRDSK
ETSL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttcgaagcagggcaggattttatcgccaggagataaacagaaccgtttgggac
gttccagagagatacagagatctaatccagatcggaaccggagcgtatggaacagtctgt
tcagccattgaccgcaagacaggagttcgagtggccatcaagaagctccacagaccgttc
cagtccagactgttcgccaagcgcgcttacagagagctacgacttctcaagcacatgaaa
catgagaatgttatcgggctgctggatgtttttacctcagaaatcttgttggacagattt
catgatttttacctggtgatgccgtttatgggcactgatctgggaaagctgatgaaaatg
gagagactgtgtgaggacagagtgcagtttctggtctatcagatactgcggggtctgaag
tatattcattcagccgggatcattcacagggatctcaaaccaggaaatctggcagtgaat
caaaactgtgaacttaagatcctggactttggacttgcgcgtcaggcggattcagaaatg
acgggttatgtggtgacccgctggtacagagcaccagaggttatcctcaactggatgcac
tactcacaaacagttgatatctggtcagtgggctgcatcatggcggagatgttacttgga
aggacactttttaaaggcaatgaccacctagaccagctgagagagatcatgaaaatcaca
ggaactccagctccggatttcatcaccaagctacaaagccaagatgccaaaaactacatc
agaggtctacctaaagtcccaaagaaagacttaaacactattttcttcaaagccagctca
gaagcggtgagtgctctggagctaatgctggttctggatccagataaacgtgtaagcgct
gcagaggcgctcgaacttcccctttttacagagttcagagaacctgaagaagagacggag
gccctgccttatgaccactccatggacaacacagaactgcctctggatcagtggaaacgt
cacacttttacagagatcctgtcattccagccgcccgtcacagagatcagagactccaaa
gaaacatcactttga

DBGET integrated database retrieval system