KEGG   Danio rerio (zebrafish): 557810Help
Entry
557810            CDS       T01004                                 

Gene name
mapk12b
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04068  FoxO signaling pathway
dre04114  Oocyte meiosis
dre04218  Cellular senescence
dre04261  Adrenergic signaling in cardiomyocytes
dre04370  VEGF signaling pathway
dre04620  Toll-like receptor signaling pathway
dre04621  NOD-like receptor signaling pathway
dre04622  RIG-I-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04933  AGE-RAGE signaling pathway in diabetic complications
dre05132  Salmonella infection
Module
dre_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    557810 (mapk12b)
   04370 VEGF signaling pathway
    557810 (mapk12b)
   04068 FoxO signaling pathway
    557810 (mapk12b)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    557810 (mapk12b)
   04218 Cellular senescence
    557810 (mapk12b)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    557810 (mapk12b)
   04621 NOD-like receptor signaling pathway
    557810 (mapk12b)
   04622 RIG-I-like receptor signaling pathway
    557810 (mapk12b)
   04625 C-type lectin receptor signaling pathway
    557810 (mapk12b)
  Endocrine system
   04912 GnRH signaling pathway
    557810 (mapk12b)
   04914 Progesterone-mediated oocyte maturation
    557810 (mapk12b)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    557810 (mapk12b)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    557810 (mapk12b)
  Infectious diseases
   05132 Salmonella infection
    557810 (mapk12b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     557810 (mapk12b)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   557810 (mapk12b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 557810
NCBI-ProteinID: NP_001038306
ZFIN: ZDB-GENE-041210-123
Ensembl: ENSDARG00000006409
Vega: OTTDARG00000007826
UniProt: Q5RHW0
Position
4
AA seq 364 aa AA seqDB search
MSLRSRAGFYRQEINRTVWDVPERYRDLIQIGTGAYGTVCSAIDRKTGVRVAIKKLHRPF
QSRLFAKRAYRELRLLKHMKHENVIGLLDVFTSEILLDRFHDFYLVMPFMGTDLGKLMKM
ERLCEDRVQFLVYQILRGLKYIHSAGIIHRDLKPGNLAVNQNCELKILDFGLARQADSEM
TGYVVTRWYRAPEVILNWMHYSQTVDIWSVGCIMAEMLLGRTLFKGNDHLDQLREIMKIT
GTPAPDFITKLQSQDAKNYIRGLPKVPKKDLNTIFFKASSEAVSALELMLVLDPDKRVSA
AEALELPLFTEFREPEEETEALPYDHSMDNTELPLDQWKRHTFTEILSFQPPVTEIRDSK
ETSL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttcgaagcagggcaggattttatcgccaggagataaacagaaccgtttgggac
gttccagagagatacagagatctaatccagatcggaaccggagcgtatggaacagtctgt
tcagccattgaccgcaagacaggagttcgagtggccatcaagaagctccacagaccgttc
cagtccagactgttcgccaagcgcgcttacagagagctacgacttctcaagcacatgaaa
catgagaatgttatcgggctgctggatgtttttacctcagaaatcttgttggacagattt
catgatttttacctggtgatgccgtttatgggcactgatctgggaaagctgatgaaaatg
gagagactgtgtgaggacagagtgcagtttctggtctatcagatactgcggggtctgaag
tatattcattcagccgggatcattcacagggatctcaaaccaggaaatctggcagtgaat
caaaactgtgaacttaagatcctggactttggacttgcgcgtcaggcggattcagaaatg
acgggttatgtggtgacccgctggtacagagcaccagaggttatcctcaactggatgcac
tactcacaaacagttgatatctggtcagtgggctgcatcatggcggagatgttacttgga
aggacactttttaaaggcaatgaccacctagaccagctgagagagatcatgaaaatcaca
ggaactccagctccggatttcatcaccaagctacaaagccaagatgccaaaaactacatc
agaggtctacctaaagtcccaaagaaagacttaaacactattttcttcaaagccagctca
gaagcggtgagtgctctggagctaatgctggttctggatccagataaacgtgtaagcgct
gcagaggcgctcgaacttcccctttttacagagttcagagaacctgaagaagagacggag
gccctgccttatgaccactccatggacaacacagaactgcctctggatcagtggaaacgt
cacacttttacagagatcctgtcattccagccgcccgtcacagagatcagagactccaaa
gaaacatcactttga

DBGET integrated database retrieval system