KEGG   Danio rerio (zebrafish): 557981Help
Entry
557981            CDS       T01004                                 

Gene name
usp32, wu:fe14d02
Definition
ubiquitin specific peptidase 32
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     557981 (usp32)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   557981 (usp32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
15
AA seq 1583 aa AA seqDB search
MGAKESRIGFLSYDEAVKRVTDVELKRLRDAFKRTSGLSVYMTQQCFFREVLGDGVPPKV
AEVIYNSFGGTSKGLHFNYLIVGLVLLTRGRDEEKAKYIFSLFASDSGTFVVREDVENML
RSVDGEVPPSLRKCFTEGEKVNYEKFKSWLLQNKDAFTFSRWLLSGGVCVTLTDDSDTPT
FYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFVPLVSPPIHASLSEGLFHAF
DENRDNHIDFKEISCGLSACCRGPVAERQKFCFKVFDVDRDGVLSRDEIHEMVVALLEVW
KDNRTDTLPEFDSSVSEIVEDILKMHDTTKQGHLTLEDYQIWSVKSALANEFLNLLFQVC
HIVLGLRPATPEEEGQIIRGWLERESRHGLQPSQNWFLISMQWWQQWKDYVRYDNKSIVM
EQPSVQGSGMRSSQSAASVEPILNRIGLVVRSPSSPEEKFPDNISSSSEASESTGLTPHI
SSSATDVCFARQHNISDNNNQCFSSANGHLPNSLAVQRPGAIDNQPLVTTEPMKAPTLTM
EGGRLKKSHQLLSGREFETVPEPVWRALYHWYGANLSLPRPVIKSTVKAQPELELFPLYL
LFLRQQPATRSPQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMCTIKDIHEYLSQRLRIK
EEDMRLWLYNSENYLTLLDDEDHTLESLKIPDEQHLVIEVRNKDMSWPEEMSFIANSSKI
DRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTKPLTEYFISGRHLYELNRTNPIGMRGH
MAKCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHEDLN
RVHEKPYVELKDSDGRPDHEVATEAWENHLRRNRSIVVDLFHGQLRSQVKCKTCGHISAR
FDPFNFLSLPLPMDSSMHLEITVIKLDGSTPVRYGLRLNMDEKYMGLKKQLSELCSLKPE
QILLAEVHTSNIKNFPLDNQKVRHSVNGFLCAFEIPVPGSPTSVTSPVQTEKPPIANGTA
GNNHIGKSGLIPNGMPSTVVPCTLEKPLANGIPNGHAVPVQDSPFIGYIIAMHRKMMRTE
LYFLSSQKNRPSLFGMPLIVPCTVHTSKKDLYDAVWIQVSRLASPLPPQEASNHAQDCDD
SLGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCTVDCNEDRASLGNAYIAVDWDPTALHLR
YQTSQERIVEEHPSVEQSRRAQAEPISLDSCLKAFTSEEELGEDELYYCSKCKTHRLATK
KLDLWRLPPVLIVHLKRFQFVNGRWIKSQKIVKFPRESFDPSAFLAPREVSQSLGSLQSL
QSECLVEELQRLERGDSSVSSISTTTLASPPISGRATPCSIRRVGSPLSRNSSPGSSPRN
TGRKQGRLRLPQLGSRHRLCNSKENLEACSTNKESESEAEQSAVTDGENLTPDANTQDTW
SLDASSNDCDVIMVNGLGQDSSQSNGHSEVSADLDTPHQRNDICLESLYNLYAISCHSGI
MGGGHYVTYAKNPNEKWYCYNDSSCKEVHSDEIDTDSAYILFYEQQGVDYSQFLPKTEGK
KMADTTSMDEDFESDYKKYCVLQ
NT seq 4752 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccaaagagtcacggataggcttcctttcgtatgacgaggccgttaaaagagtt
accgatgtggagctcaaacgtctgcgagatgcctttaagaggaccagtggcctgtcagtg
tatatgacccagcaatgcttcttcagagaagtcctgggcgacggagtgccaccaaaggtt
gcagaagtgatctacaactcatttggtggcacatccaaagggctacacttcaactatctg
atcgtcggcctggttttgttaacaagagggcgtgatgaagagaaagccaaatacatcttc
agcttgttcgcgagtgattctggcacctttgtggtccgggaggatgtggagaacatgctg
cgctcagtggatggggaggtcccgccttctctcaggaagtgctttactgagggggagaag
gtgaattatgagaagtttaagagctggctgcttcagaataaagatgctttcacgttctcc
cgctggctgctgtcaggtggtgtgtgcgtaacgttgactgacgacagcgacacacccacc
ttctatcaaaccctggcaggtgtcactcacttagaagaatcagacattatcgacttggaa
aaacgctactggctgctgaaagctcaatcaaggacaggccgctttgatttggaaaccttt
gtcccgctggtctcgccccctattcatgcatcgctgagtgaaggcttgtttcacgccttt
gatgagaatcgggacaatcatattgactttaaggagatatcctgtgggctctcagcttgc
tgtcgcggcccagtagcggagaggcagaagttttgttttaaagtgttcgacgtagatcgt
gatggagttttgtccagggacgagatccacgagatggtggtggcgctgctggaggtgtgg
aaggataaccgaacagacactcttcctgagtttgattccagtgtgtcagagattgtggag
gacatattgaaaatgcacgacacaacaaaacaaggacatttaactctagaggactatcag
atatggagtgtgaaaagtgccctcgccaatgagttcctcaacttgctgtttcaggtgtgt
catattgtcctgggcctgcgtcctgccacccctgaagaggaaggccagatcattaggggt
tggttggagagggaaagcaggcacggtttacagcccagtcaaaactggttcctgatctcc
atgcagtggtggcagcaatggaaagactatgtcagatatgataataagtcgattgtcatg
gagcagccatcagtgcagggcagcgggatgagaagttctcagtctgctgcatctgtagag
cctatcctcaacagaattggattagtggttcgctcccccagttccccagaagaaaaattc
cctgacaacatctccagctcatcagaggcttcagagagcactggcctaaccccacacatc
agctcctctgccacagacgtgtgctttgctcggcagcacaacatctctgacaacaacaac
cagtgtttctcaagcgccaatggccatttgcctaacagcttggccgtgcagagacccggt
gcgatagacaaccagcctctggtgaccaccgagcccatgaaggcacccacgctgactatg
gaaggaggtcgactgaagaagtcccatcaactgttgtctggccgggagtttgagacggtt
ccagagccggtgtggagagcactttaccactggtatggggccaaccttagtctgccccga
ccggttatcaagtctacagtcaaggcacagcctgagctagagctcttccccctttacctt
ctgttcctgcgacagcaaccggccacacggagccctcagtccaacatctgggtcaatatg
ggtaatgttccttctcccaacgccccgctcaagcgagtgctggcatacacaggctgtttc
agcagaatgtgcaccattaaagacattcacgagtacctgtcccagaggttacgcatcaaa
gaagaggacatgcgcctctggctttacaacagcgagaattacctcactctcctggacgat
gaagatcacactttagaaagcttgaaaattccagatgaacagcacttagtcattgaggtt
cgaaacaaagatatgagctggccagaggaaatgtctttcattgcaaacagcagcaaaatc
gacagacacaaagttcctactgagaaaggtgccacaggtttgagtaatctgggcaacacg
tgcttcatgaactccagtattcagtgtgtaagcaataccaagcccctcactgagtacttc
atctcagggcgacacctttatgagcttaatagaactaatccaataggaatgcgtggtcac
atggccaaatgctatggtgatttggtacaggaactatggagcggcactcaaaagaatgtt
gcgcctttgaaacttaggtggacgatagcaaagtacgcgccaagattcaatggcttccag
cagcaagactcccaggagcttttggccttcctgttggatgggcttcatgaagacttgaat
cgtgtgcatgagaagccgtatgtggagctcaaggacagtgatggacggccggaccatgag
gttgctacagaggcctgggaaaaccatttgcggagaaatcgctctatcgtggtggacctc
ttccatgggcagctcagatcccaggtgaagtgcaagacctgtggccacataagcgcacgc
ttcgacccctttaacttcctatcgctgcctctgccaatggacagctccatgcacttagaa
atcacagtcatcaaacttgacggctccactccagtgcgatacgggctccgtctcaacatg
gatgagaagtacatggggctaaaaaaacagctgagcgagctctgtagcctgaaacctgag
cagatcctactggccgaagttcacacgtccaacatcaagaactttcctctggataaccag
aaggtgcgacactctgtcaacggcttcctctgtgcgtttgagatccctgtgcctggttca
cccacttcagtcacttctcctgttcaaacagaaaaaccacctattgccaatgggacagca
ggaaacaatcatattggaaagtctggcctgattcctaatggtatgcccagtacagtggtc
ccctgcacccttgagaaacccctcgccaatggtatccccaatggccatgctgtgccagtg
caggacagcccattcattggctacattattgccatgcacagaaagatgatgcggacggaa
ctgtacttcctgtcctctcagaagaacaggcccagtctgtttggtatgcctctgattgtg
ccatgcacagtgcacacgagtaagaaggacctgtatgatgctgtgtggattcaagtgtcc
cgacttgcaagtccactgccgccgcaggaagccagcaaccatgctcaagactgtgatgac
agtttgggctatcagtacccctttacgctgcgggtggtgcagaaagatggtaactcctgt
gcctggtgtccctggtacaggttctgcagaggctgcacagtggactgtaatgaagacaga
gcatctttggggaatgcctacattgctgtagactgggatcccaccgccttgcaccttcgt
taccagacgtctcaggaaaggatagttgaagagcatcccagtgttgagcagagtcgacgc
gctcaagcagagcccatcagtctggacagctgtctgaaagccttcaccagtgaagaagag
ctgggagaggacgagctctattactgctccaagtgtaaaacacaccgcctggccactaag
aagctggacctctggaggctgcctcctgtactgattgttcatttgaaacgcttccaattt
gtaaatggtcgatggatcaagtctcagaagattgtgaagtttccacgcgagagcttcgac
cccagtgcgttccttgccccacgggaggtgtctcagagccttggcagcctgcagagcctg
cagagcgagtgcctggtggaggagctccagaggctggagagaggagactcctctgtgtcc
tccatctccaccaccaccttggccagtcctcccatatctggcagagccaccccgtgctcc
atcaggagggtcggcagtcccctgagcagaaacagcagtcccggcagcagccccagaaac
acaggccgaaaacagggccgcttgcgtcttccccagctgggcagcagacatcgactctgc
aacagcaaagaaaacctggaagcctgtagcaccaacaaggagagcgagagcgaggccgag
caaagcgcagtgacggacggggagaatctgacccctgatgccaacacacaagacacctgg
tcactagacgcctccagcaacgactgcgatgtcattatggtgaatggactaggacaggac
agcagtcagagcaatggacattcagaggtcagcgccgatctggacacccctcaccaaaga
aatgacatctgcctggagtccctgtataatttatatgcaatctcatgccattcgggaata
atgggaggggggcactatgtgacttatgccaaaaaccccaacgaaaaatggtactgttac
aatgacagcagctgcaaggaagtgcactcggacgagattgacacagattcagcctacatc
ctgttttatgagcaacagggagtggactactcgcagtttctgccaaaaacggagggcaag
aagatggcagacaccactagcatggatgaagactttgaatctgactacaagaagtactgt
gtgctgcagtga

DBGET integrated database retrieval system