KEGG   Danio rerio (zebrafish): 558011Help
Entry
558011            CDS       T01004                                 

Gene name
usp13, wu:fc61g08
Definition
ubiquitin specific peptidase 13 (isopeptidase T-3) (EC:3.4.19.12)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     558011 (usp13)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   558011 (usp13)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   558011 (usp13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
6
AA seq 860 aa AA seqDB search
MATDLGELLVPYMPTIRVPRTGDRVFKSECAFSYDSPESEGGLYVCMNSFLGFGREHVER
HYRKTGQSVYMHLKRHVKEKATGAAGGAIPRRRNGKVFLDLELNRDFNGDDYEYEDEAKL
VIFPDHYEIPLPNIEELPALVTIACDAVLNAPSPYKKQESDSWEEEIQVSRHARSLRQLD
NGVRIPPSGWKCAKCEMRENLWLNLTDGSVLCGKWFFDGSGGNGHALEHYRESNFPLAVK
LNTITPDGADIYSFDEEEAVLDPHISEHLLHFGIDMLQMQRTENGHHTDNHVQPRISDWE
VIQEAGLKLKPVYGSGYTGIKNLGNSCYLSTTMQVLFSIPEFQRAYAGNLQRIFDYSPLD
PTQDFNTQMAKLGHGLLSGQYSKPPMKSELIEQVMKEEHKQQQQRGISPKMFKALVSKGH
PEFSSNRQQDAHEFLLHLINLVERNNSGSENPSDVFRFIVEERTQCCQSQKVRYTQRVDY
LMQLPVPLEAASNREELIAYEGKRKEAEENMRPLPEVVRARVPFTACLQAFTEPENVPDF
WSSALQAKSAGVKTSRFATFPEYMIVQLKKFTFGVDWVPKKLDMSVDVPDFLDLNRLRAT
GLQAGEEELPDLTPPIVIPEDTRDSSTNNSLESPEIDESSVMQLAEMGFPLEACRKAVYY
TGNMGAEMAFNWIIAHMEEPDFAEPLAVPTYMESDLPSPSLPTTSALDNQPPEESISILT
SMGFPRHHTIRALKASNNNLERALDWIFTHPDCEDESEAMSDTADTEPNDNSFSNANAHT
DSSLSPDQDLSSPRVRDGPGRYELFAFISHMGTSTMSGHYVCHIKKEGRWLIYNDHKVCL
SERPPKDLGYMYFYRRLSSC
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggctacagatctgggagagctgctggtcccgtacatgcccaccattagagtaccgagg
acaggagacagggttttcaagagcgagtgcgctttttcctacgactctcctgaatcagaa
ggtggtctgtatgtgtgtatgaactcattcctgggttttggaagagaacacgtggagaga
cattaccgtaaaactggacagagtgtgtacatgcacttaaagcggcatgttaaagagaaa
gccacaggtgctgcagggggtgccataccaagaaggaggaatggaaaagtatttttagat
ttagagcttaaccgtgattttaacggggatgattatgagtatgaagatgaagccaagctt
gtcatatttccagaccactatgagatccctctaccaaatattgaggagttgcctgcactg
gtgacaatagcctgtgacgccgtcctcaatgctccatctccatacaaaaagcaggaatca
gattcatgggaagaggagatccaagtttctagacatgctagaagtctaagacagcttgat
aatggcgttcgaattcctcccagcggatggaagtgtgccaagtgtgaaatgagagagaac
ctgtggctaaacctgacggatggctctgtcctctgtgggaaatggttctttgatgggagc
ggagggaacggacatgcccttgagcactacagagaaagcaacttccccctggcagttaaa
ctcaacacaatcaccccagatggagcagatatttattcctttgatgaagaagaagcagtg
cttgatcctcacatatctgaacatttattacacttcggaattgatatgctacaaatgcaa
aggacagagaatggccatcatacagacaaccacgttcaaccgcgtatcagtgactgggaa
gtgattcaggaggcaggtctaaagttaaagcctgtctatggttcaggatatacaggcatc
aaaaacctgggcaacagctgctacctgagcaccactatgcaagtgcttttcagtattcca
gagttccagagagcgtatgctgggaacctacagagaatatttgactactcacccctcgat
ccaactcaggatttcaacacacagatggcaaaacttgggcatggacttctctcaggccaa
tactctaaacctccaatgaaatcagaacttattgaacaggtgatgaaagaagaacacaag
cagcagcagcaaagggggatttcacctaagatgttcaaagcgctggtcagtaaaggacat
ccagagttctcctcaaatcgacaacaagatgcccatgaattcctcttgcacttaattaac
ctggttgagaggaacaattcaggctctgagaaccccagcgacgtgttcagatttattgtg
gaggagcgaacacagtgctgtcagtcgcagaaggtgcgatacacacagcgagtggactac
cttatgcagcttcctgtgcctttagaggcagccagcaacagagaggagctaatagcatat
gagggtaaacggaaggaagccgaggagaacatgcggccccttccagaggtggtgagagcc
agagtgcctttcactgcctgtctgcaagccttcactgagccggagaatgtgccagacttc
tggagctctgcgctgcaggccaaatcagccggagtgaagacttctcgttttgcaactttc
ccagagtacatgatcgtgcagctaaagaagttcacatttggtgtcgattgggtgcctaaa
aagttagatatgtcagtagatgtacctgatttcttggatctgaatcgccttagagccaca
ggtctacaggctggagaagaggaattgcctgatcttacacctcccattgtcattcctgaa
gacacccgagacagttcaacaaacaactctttggaatctccagaaatagatgaatcatct
gtgatgcagctggcagagatgggctttcctttggaagcctgtcggaaggctgtgtactat
actgggaatatgggagcagagatggcctttaactggataatagcacacatggaggagcca
gattttgctgagcctctggctgttcccacttacatggaatcagatctgcccagtccgagt
cttcctacaaccagtgcactggacaaccagcctccagaggagagcatctccatcctcacc
tctatgggcttccccaggcatcacacaatccgggccctcaaagcctcaaacaacaacttg
gaacgagctcttgactggattttcacacacccagactgtgaggatgaaagtgaagctatg
tcagacacagcagacacagagccgaatgataacagcttctcaaacgccaacgcccacact
gactcctcactgtctccagatcaggatctgtctagccctcgagtcagagacggacccggc
cgttacgaactgtttgctttcatcagtcacatgggaacatccacaatgtctggccattat
gtgtgtcatatcaaaaaagagggcagatggctgatttacaatgaccataaagtatgtttg
tcagagaggcctcctaaagacttgggctacatgtacttttaccggcgcctgtcaagctgc
taa

DBGET integrated database retrieval system