KEGG   Danio rerio (zebrafish): 558499Help
Entry
558499            CDS       T01004                                 

Gene name
chka, im:7143625, si:dkey-12e7.3, wu:fd46h01
Definition
choline kinase alpha (EC:2.7.1.32)
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    558499 (chka)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     558499 (chka)
    2.7.1.82  ethanolamine kinase
     558499 (chka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
18
AA seq 400 aa AA seqDB search
MKTKFINGVSSSPSMSLGLLVNESVLEVQPDSVNDCKDIIRPDEPDQQTKHKAYLWCREF
LHGAWKSIDEEDFQISIIRGGLSNKLFLCALPEMQASLGDEPRNVLLRLYGEILQGADAM
VLESVMFAILAERELGPKLYGIFPQGRLEQFVPSRKLTTDELSVPGINAEIAEKIARFHG
MRMPFNKEPKWLFGTMEKYMDQVLQLTFTREPHLRNFSRILSYNLPQEMDNLKCLLESTP
SPVVFCHNDLQEGNILLLNGRENTDRQRLMLIDFEYSSYNYRGFDIGNFFCEWTYDYTYD
KFPFFTNNTKNYPTKAQQMHIFHSYLLESDAGFKHLSEEDQMKLKEDMLVEVNRFALASH
FFWGLWSMIQAKISTIEFGYMEYAMARFDAYFELKRKLGV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagactaaattcatcaatggcgtgtcttcttcgccttcaatgtctttgggtttgctg
gtgaatgaaagcgtcctcgaagtccagcccgacagtgtgaacgactgcaaagatattatc
cgaccggatgagccagaccagcagacgaagcataaggcgtatctgtggtgtagagaattc
ctccacggagcctggaaatccattgatgaagaggattttcaaatctcaatcatcagagga
ggcctgagcaacaaactgttcctctgcgctttgccagagatgcaagcaagccttggagat
gaaccacgaaatgtgctccttcgcctatatggagaaattctgcagggagctgatgccatg
gtactggagagtgtgatgtttgctatcctggccgagagggagcttgggcccaagctctat
ggcatctttccacaaggcaggctggaacagtttgtcccaagtcgaaaactgaccacagat
gagctgagcgtccctggtataaatgctgagattgctgaaaagatcgccagatttcacgga
atgagaatgcccttcaacaaggagccaaagtggctttttggcaccatggaaaagtacatg
gatcaagtgcttcagctcaccttcaccagggaacctcatctgcgaaacttctctcgcatt
ttgagctacaacttgcctcaagagatggacaatctcaagtgcctacttgaatctaccccc
tctcctgttgttttctgccacaatgacctgcaagaaggaaatatcttacttctgaatggc
cgtgagaacacagacagacagaggctcatgctgattgacttcgagtacagcagctacaac
tacagaggatttgacattggaaatttcttctgtgagtggacctacgactacacctatgac
aagttcccattcttcacaaacaacaccaaaaattaccccaccaaagcacagcagatgcat
atctttcacagttatctgttggaatccgatgctggatttaaacacttgagtgaggaggac
cagatgaagctcaaagaagatatgctagtggaggttaacaggtttgctctggcctcccac
ttcttttggggattgtggtccatgatccaggccaaaatatctacaattgagttcggatac
atggagtacgccatggccaggtttgatgcctactttgagctgaagaggaagctcggggtt
taa

DBGET integrated database retrieval system