KEGG   Danio rerio (zebrafish): 558958Help
Entry
558958            CDS       T01004                                 

Gene name
lamc3, si:dkey-245l10.1
Definition
laminin, gamma 3
Orthology
K06247  
laminin, gamma 3
Organism
dre  Danio rerio (zebrafish)
Pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    558958 (lamc3)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    558958 (lamc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 1643 aa AA seqDB search
MDSSALHSLLLLLFASVYFVFAGMDSCYDENGVPSLCLPKFENAAFNHSVMVSNMCGIPP
EDYCMQTGSTRSCHHCDAFDSELNRNATYLTDFHTDEEPTWWQSQSMFYGVQYPNSVNIT
LHLGKAFEITYVRLKFYTSRPESFAIYKRTDENGPWQPYQYYSASCRKTYGRDNKGFIRP
GDNERTPLCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDQSLVLQDWVTATDILISLDRL
NTFGDEFFKDAKVLRSYFYAISDFSVGGRCKCNGHASECVVNEEGRSVCVCEHNTAGVDC
QLCAPFYQDRPWARATAHSANECVRCNCSGLADECVFDVEQYRSTGQGGRCLGCRENTAG
PHCEQCRENYFRSSALQPCQNCNCNALGSVSLQCDADGVCVCWPSVSGVKCDICKSGFHS
LGPGGCRLCDCDERGSVGVCSAEDGRCHCKANVEGQSCNRCKPGSFNLQLENPDGCNKCF
CFGHSLACFSSNQYTPIYITSDFLEDPDGWKGVFSRAHEQSLIWKEGEVYLLPYREENGF
YKAPDKYLGNMLLSYGRTLSMSFTAELEELLPRSVTVRLEGSGMSVSADLHTQQEPYSQL
EKTPINSFSLRLTEKHVNPSVSSFEFLRMLYNLTALHISNAGGQNYTSQLSRVSLESAVQ
KAYHPDVLPHALWVEVCSCPAGFAGQFCQLCAPGFTRETPDGGPFSPCVPCNCNQHGTCH
PETGVCACTDFTTGRHCERCEDGYYGNALTGSPGDCLPCPCPDRTTCAQVPETGDVICTN
CPTGQRGVRCELCEDGFYGNPLGWGGTVQPCVKCQCNGNVDANAVGVCDHMTGRCLKCLG
HTTGDHCEKCRLGYYGNALANQLNPERKCKPCACNVAGTSGSPNDCHPNTGNCVCLGHVT
GRDCGQCEAGYFNLQPGLGCEMCNCNPIGSLSSACHPITGQCMCRTGVEGMSCDTCRMGF
FGFSSRGCRACNCDPMGSTSMQCHNNGTCSCRNGFVGYKCDKCEQNYYQNRLSHQCEECP
VCYSIIRDQASKLKARLQELELLLSSYDCNRYSRQYRGHQQHRHQHNDLDNHIQKDQVED
YLPNALEDLLAIQEAREAFIKQFSQLETSAQTLQLQLRNIATALNCNLTNFAKHPEEGKT
QKVENECRELVDTLSTALNMQDQLQKMTVELNSMAIPAVIPKEPNKWNAIVNESEVLVKS
HTDMAAHIEQVAEDVFKMANRTYLQLVTLLEDNSTESHIQDLTEKLEEMQQLKENLTLEV
NETLVTHLSLQKHNAEIADILHNITASLSELRRTDGNFTLVVEETNMTSFSQTFNQTNVT
AAQNPQLTESEDLMNRTTNLDISVQSKEHLVNKTREEIQPDMDSAKNNLKTVQELKQLTA
AVEGLKVSAVSSVVTGKEVEAEILSLQKSLQDMEQDWPQLPTLSKSFLKREKMLNEKTLV
EVKKRVKQTEKMIKPSVENATDADSTAKQAEASADTVAKDAKASFTQGKRIKHASGQLRS
ALDVTLEQLSELESQTALKQATLEAEEDMVSSSSVIDSMETAKNQLESFTDMLTLLLSQM
EADVVLENYDRILNETAVRLRVLQGAVESPSLTGKIQRLRNAASDQEKQMQNLEESLQDI
RKERDSLTDIAQNLPKTCPQKGH
NT seq 4932 nt NT seq  +upstreamnt  +downstreamnt
atggattcctctgcacttcactctcttttacttctgctttttgccagcgtctactttgtt
tttgctggaatggactcttgttatgatgaaaatggtgtcccgagcttgtgtttacctaaa
tttgaaaatgcggccttcaatcattccgtgatggtttcaaatatgtgcgggatcccacct
gaggactactgcatgcagactgggtccacgcgctcttgtcatcactgtgacgccttcgac
tctgagctaaatcgtaacgccacttacctgacagacttccacacggatgaagagcccacc
tggtggcagagccagtccatgttctatggagttcagtacccgaattcagtcaacatcact
ctgcatcttgggaaggcttttgagatcacctatgtccgtttaaagttctacaccagtcga
ccagagagcttcgccatctacaagcgtacagatgagaatggaccgtggcagccgtaccaa
tattacagcgcttcctgtcgtaagacgtacggaagagacaacaagggcttcatacgtcca
ggtgataacgaaaggacgccactttgcacggatgagtttagtgacatctctccgctgaca
ggcggaaatgtggccttctccacattagagggacgaccaagtgcctacaactttgaccag
agtcttgtgttgcaggactgggtgacagctacggatatcctcatctctctggacagactg
aacacttttggagatgagttcttcaaggatgccaaagtgcttcgctcatatttttatgcc
atttctgatttctctgtggggggcaggtgcaagtgtaatggccatgcaagcgaatgtgtg
gtcaatgaggaaggccgttcggtgtgtgtttgtgagcacaacaccgcaggggtcgactgt
cagctctgtgctcccttctaccaagacagaccttgggcacgagcgactgctcattctgcc
aacgagtgtgtgaggtgtaactgcagtggtcttgccgatgaatgtgtgttcgatgtggaa
cagtaccgcagcacaggacaaggggggcgctgtctcggctgtagggaaaacactgctggt
cctcattgtgagcagtgcagagaaaactacttcagatcatcagcactgcagccctgccaa
aactgtaactgcaatgcattaggctctgtgagtttgcagtgtgatgcggatggagtgtgt
gtttgctggccaagtgtgtctggtgtgaagtgtgacatttgcaagtctggcttccattct
cttggccctggtggatgcaggttgtgtgactgtgatgagaggggcagtgtaggagtgtgt
tcagctgaagacggacgctgccactgcaaagcgaatgtggagggacagtcctgcaacagg
tgtaagccaggatccttcaacctccagctggagaatccagacggctgtaataaatgcttt
tgctttggtcactccctcgcctgtttctcctccaatcagtacacgccaatttatatcact
tcagactttctagaagatccagatggctggaagggtgttttctccagagcccatgaacaa
tctctgatctggaaggagggagaagtctatctgttgccctaccgagaggagaacggcttc
tacaaagcacctgataaatatcttggaaacatgttgctaagttacggacggacccttagc
atgtcatttacagccgagctggaggagctgttgcccagaagtgtgactgtgaggctggag
ggctctgggatgtcagtttctgctgatttacacactcaacaggagccttattcacagctg
gaaaagacacccattaactccttttctctcaggttaacagagaagcacgttaatccatct
gtatcatcatttgagtttctccgcatgctttacaatctgacagctctacatatcagtaat
gcaggaggccagaactacacatctcaactctccagagtaagcctggaatctgcagtccag
aaggcctatcatccagatgtgctccctcatgctctgtgggtggaggtgtgctcctgtccc
gcaggattcgcaggccagttctgtcaactctgtgctcccggattcaccagggagacccct
gatggtggacccttctccccttgtgtaccttgcaattgcaatcagcatgggacctgccac
ccggagacaggtgtgtgtgcctgcacagactttaccaccggccgtcattgtgaacgttgt
gaagatggttactatgggaacgcactgactggcagcccaggcgactgcttaccttgtcct
tgtccagatcgcaccacctgcgcccaggtgccagagacaggggacgttatttgtaccaac
tgtccgacaggccaaaggggtgtacgatgtgaattgtgtgaagacggtttctatggcaac
cctctgggctggggtggcacagtgcaaccctgtgtgaagtgccagtgtaatgggaatgtg
gatgccaatgcagtgggtgtgtgtgatcacatgactggacgctgtctgaaatgtctgggc
catacgactggggaccattgtgaaaaatgcagattgggttactacggcaacgcactggcc
aaccaactcaatccggagcgaaagtgcaaaccttgtgcctgcaacgtggctgggacatca
gggtctccgaatgactgccatccaaatacaggaaactgtgtttgcctgggtcatgtgaca
ggacgagactgtggacaatgcgaggctggatacttcaatctgcagcctggattgggctgt
gagatgtgtaactgcaatcccattggctcattgtcttcagcatgtcatccaatcacagga
cagtgcatgtgtcgaacaggtgtcgaagggatgtcatgtgacacttgccgaatgggattc
tttggtttctcctcaagaggctgcagagcttgtaattgtgaccccatgggctcgacctca
atgcagtgccacaacaacgggacgtgttcttgtcgcaacgggtttgttggttataagtgt
gacaagtgtgaacagaactactaccagaaccgcctgagccaccaatgcgaggagtgtcct
gtgtgctacagcatcattagagaccaggccagtaaactgaaagctagactgcaggagttg
gagttgctgctcagtagttatgactgcaatagatacagccggcagtatcgtgggcaccag
cagcacagacaccaacataatgacctggataatcacatacagaaggaccaggttgaagac
tacctgcccaatgctcttgaggatctccttgctattcaagaggctcgtgaagccttcata
aagcagttctcacagctggaaacatctgcccagaccttacagctgcagctgcgaaacatt
gcaacagccctgaactgcaaccttaccaactttgcgaagcatccagaggaaggaaagact
caaaaggttgaaaatgagtgtcgagagcttgttgacactttatcgaccgctctgaatatg
caggatcagcttcaaaagatgactgttgaacttaacagcatggccatcccagctgtaatc
cctaaagaacccaacaaatggaatgccatagtgaatgaatctgaggttctggtgaaaagt
cacacggatatggcggctcatatagagcaggtagcagaagatgtctttaaaatggctaac
agaacctatttgcagctggtaactcttctagaggacaactccacagagtctcacatacag
gatctcacagagaagctggaggagatgcagcagctgaaggagaatctgactcttgaggtt
aatgagacattagtgacacacctgtcacttcagaaacacaacgcagagatagcggacatt
ttacacaacatcactgcttcactgtcagaactacgcagaacggatggcaatttcaccctt
gttgtggaggagaccaacatgacctctttctcacagacgtttaatcaaaccaatgtcaca
gcagctcagaatcctcaacttacagagagtgaagacctgatgaacagaacaaccaattta
gacatttctgttcagtccaaggagcatttggtaaataagaccagagaagaaatccagccg
gatatggacagtgccaaaaataacctgaaaactgttcaagagctgaagcagttgacggct
gcggtggagggattgaaggtgtcagccgtctcctctgtggtgactgggaaagaggtggag
gcggagattctgtctctgcaaaagagtctgcaagacatggagcaggactggcctcaactg
cccacgctcagcaaaagctttctgaagagagagaagatgctgaacgagaagacactggtg
gaggtgaaaaaaagagtgaagcagacagagaagatgatcaagccctcagtggagaatgcg
acagatgcagacagtacagctaaacaggccgaggcgtcggcagacacggtggctaaagat
gccaaagcctccttcacgcaggggaaacggataaaacatgcatctggacagttgcgttca
gctctagacgtcaccctggagcagttgtctgagctggagagccaaaccgcactgaaacag
gcaacattggaagcagaggaggacatggtttcttcaagcagtgtgatagacagcatggag
acggccaagaatcagctggagtccttcacagacatgctcactctgcttctcagtcaaatg
gaagctgatgtggttctggagaactacgatcgcatcctaaatgagacagcagtgcgtctt
cgtgtcctccagggggccgtggagagtccgtctctcaccgggaagatccagaggcttcgc
aacgccgcgtctgatcaagagaagcagatgcaaaatcttgaagagagcctgcaggacata
cgaaaggaaagagacagtctaacagacatcgcccagaacctgcccaaaacatgcccacaa
aaaggccactga

DBGET integrated database retrieval system