KEGG   Danio rerio (zebrafish): 558981Help
Entry
558981            CDS       T01004                                 

Gene name
clk2a, clk2, fb20c02, si:ch211-81a5.7, wu:fb20c02
Definition
CDC-like kinase 2a (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
19
AA seq 526 aa AA seqDB search
MPHSRRYPSSERASRSSYQDRYRERDRDRDRGRKPRHRRSPTYSSSSERERRARGHRQDT
GYARSRSYDNRSSDRRPYDRHYGESYRRLDHSRERDRDQNRDHRTPSNYYSRDASPSYDF
RRGRDRDREDSYRRKGSRRKHKRRRRRTRSYSASSSRSDSGTRALCVRDDEEGHLICRSG
DVLQERYEIVSTLGEGTFGRVMQCIDHRRGGAHVALKIIKNVEKYKEAARLEINVLERIN
EKDPENNNLCVQMFDWFDYHGHMCISFELLALSTFDFLKENNYLPYSINQVRHMAYQVCL
AVKFLHENKLTHTDLKPENILFVNSDYTVTYNVEKKRDERTVKNTAVRVVDFGSATFDHE
HHSTIVSTRHYRAPEVILELGWSQPCDVWSIGSILFEYYLGFTLFQTHDNREHLAMMERI
LGPVPSRMIRKTRKQKYFYRGRLDWDENSSAGRYVRENCKPLRRYLLSEAEEHHQLFDLI
EAMLEYEPSKRLTLAAALRHPFFQSGISSSELSAGKSWEANRDISR
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgccacactccaggcggtatccgtcctcggagagggccagccgcagcagctaccaagat
cgatatagagagcgggacagagacagagatcgaggaagaaaacctcgacatcgccgctct
ccaacctattcttccagcagtgaacgtgagaggagagcgagaggacacagacaggacacc
ggctatgccagatccaggagctacgacaaccgttcttcagaccgcaggccatacgacaga
cactacggcgagagctaccggcgcttggaccacagcagggaacgggacagggatcaaaac
agggatcaccggacgccgagcaactactactctcgcgacgcctcgcccagctacgacttt
cgccggggacgcgaccgggaccgcgaggactcataccggaggaaaggcagcaggcgtaag
cacaaacgaaggcggcgtagaaccaggtcctatagcgcatcctcctcgcggagtgacagc
gggacgagggcactgtgtgtgagggacgacgaggagggtcacctgatctgtcggagtggc
gacgtcctgcaagagagatatgagattgtcagcactttgggtgagggcaccttcgggagg
gtgatgcaatgtattgatcatcgcaggggtggagcacatgtcgctctgaagatcatcaaa
aatgtggagaagtacaaagaggctgcccgcctggagatcaacgtactggaaagaatcaac
gaaaaggatcctgagaataataatctgtgtgtgcagatgtttgactggtttgattaccat
ggccatatgtgcatcagtttcgaactcttggctctcagcacttttgatttcctcaaagaa
aacaactacctgccgtactccatcaaccaagtccgtcatatggcctaccaggtctgcctg
gctgtcaaatttttacatgaaaacaaactgacacacacagatctgaaaccagaaaacatc
ctgtttgtgaactcggactacacagtcacgtataatgttgagaagaaacgagatgagcga
actgtgaagaacacagcagtgagagtggttgatttcggcagcgctacctttgaccatgag
caccacagcaccattgtttccaccagacactacagagctcctgaagttattttagaactg
ggttggagtcagccgtgtgacgtatggagtattggctccatcctcttcgagtactacctc
ggcttcaccctcttccagactcatgataatcgggagcatttagctatgatggagagaatt
ctgggccctgttccttcccggatgattcggaaaactaggaaacagaagtacttttatcgt
ggacgcctggactgggatgagaactcttcagcaggaagatacgtcagagaaaactgcaaa
cctttacggcgatatcttctgtctgaagctgaggagcatcaccagctgttcgacctgatc
gaggccatgctggagtacgagccatcgaagcgtctgactcttgctgcagctctcaggcat
ccgtttttccagagcggcatcagcagcagcgaactgagcgcaggtaagagctgggaggca
aaccgtgacatcagccggtga

DBGET integrated database retrieval system