KEGG   Danio rerio (zebrafish): 559072Help
Entry
559072            CDS       T01004                                 

Gene name
gba, si:dkey-19n13.4
Definition
glucosidase, beta, acid
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dre  Danio rerio (zebrafish)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dre00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dre00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dre04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
16
AA seq 518 aa AA seqDB search
MRETALFILLAGIITTARADSKDGCLALNFGHGSVVCVCNATYCDSLGRTVLPDAGQFLS
YVSNKAGSRLMESQGQFQKNSTGAALRITLNPSQKFQHIKGFGGAMTDAAAINILSLSSG
AQDQLLRQYFSTDGIEYRFVRVPVASCDFSTRLYTYADTPEDYDLQNFTLAKEDVHMKIP
LLQRAQALSAQPLYLFASAWSAPAWLKTNGALIGKGSLKGKPGGKEHKTWAQYYIRFLEE
YRKYNLSFWGLTSGNEPTAGEMTNYSFQALGFTPETQRDWIALDLGPALHSSSFSKTQLM
ILDDNRLMLPHWAKVVLSDIKAARYVHGIGVHWYFDRLVPPDVTLTSTHHLYPDYFLFAT
EACAGWSPVDRGVRLGSWDRAEDYAHDIIQDLNNYVTGWTDWNLALNQDGGPNWVKNFVD
SPIIVDPSKDIFYKQPTFYSMAHFSKFLWEESQRVGVSFSQQTSLEMSAFIRPDASAVLI
ILNRSEEEVPFEVWDQTVGFLPGSAPPHSILTLLWNRQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaacggctctttttattctgctcgccggaataatcaccacagcaagagctgac
agtaaagacggttgtctagcactgaatttcggtcatggctcggttgtgtgtgtgtgcaat
gcgacatactgcgactctctcggccggactgtgctgccagatgctggtcagttcttatca
tatgtcagcaataaagctggcagcagactgatggagagtcaaggacagttccagaagaac
agcacaggtgcagctctcagaatcactctgaaccccagtcagaagttccagcacattaag
ggattcgggggagccatgacggatgcagcagccattaatattttgtctctgtcttccgga
gctcaggaccagctgctcagacagtacttctccacagatggtatagagtaccgtttcgtg
agagtgccggtggccagctgtgatttttcaactcgactctacacgtatgctgacactcca
gaagactacgatctccagaacttcaccctggccaaagaggatgttcacatgaagattccc
cttctgcagcgggcacaggctctatctgctcagcctctctatctgttcgccagtgcctgg
agcgcccccgcctggctgaagaccaacggcgcactgatagggaagggctccctcaaaggc
aaaccaggaggcaaagaacacaagacctgggctcagtactatatcaggtttctagaggaa
tacaggaagtataatctttcgttctgggggctgacgtcagggaatgagcccactgcaggt
gaaatgacaaattacagttttcaggctttgggttttactccggagacgcagcgtgactgg
attgccctggatctaggtccagcactccattcctcatccttttccaagacccaactaatg
attcttgatgacaaccgccttatgctgccacattgggccaaagtggttctaagtgacatt
aaagcagcacgatatgtccacggcattggtgttcactggtattttgatcgccttgtgccg
cctgacgtcaccctgacctccacacaccatctgtaccctgattacttcctatttgcaact
gaggcatgcgctgggtggagtccagtggatcgtggtgtgcgtctgggcagctgggacagg
gcagaggactacgcccatgacatcatccaggacctgaataattatgtgaccggctggacc
gactggaatttggcccttaatcaggatggaggacccaactgggtcaagaactttgtggac
agtcccataattgtggacccaagcaaagatatattttacaagcagcccacattctacagc
atggcccacttcagcaagttcctgtgggaggagtctcagcgagtaggtgtgtcctttagt
cagcagaccagcctagaaatgtctgcattcatcagacctgacgcctcagcagtattaatc
attctaaacaggtctgaagaggaggtgccatttgaagtctgggatcaaacggtgggcttt
ttgccaggaagtgctccacctcactccattctcacactactgtggaacagacagtaa

DBGET integrated database retrieval system