KEGG   Danio rerio (zebrafish): 559072Help
Entry
559072            CDS       T01004                                 

Gene name
gba, si:dkey-19n13.4
Definition
glucosidase, beta, acid
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dre  Danio rerio (zebrafish)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    559072 (gba)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    559072 (gba)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    559072 (gba)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     559072 (gba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
16
AA seq 518 aa AA seqDB search
MRETALFILLAGIITTARADSKDGCLALNFGHGSVVCVCNATYCDSLGRTVLPDAGQFLS
YVSNKAGSRLMESQGQFQKNSTGAALRITLNPSQKFQHIKGFGGAMTDAAAINILSLSSG
AQDQLLRQYFSTDGIEYRFVRVPVASCDFSTRLYTYADTPEDYDLQNFTLAKEDVHMKIP
LLQRAQALSAQPLYLFASAWSAPAWLKTNGALIGKGSLKGKPGGKEHKTWAQYYIRFLEE
YRKYNLSFWGLTSGNEPTAGEMTNYSFQALGFTPETQRDWIALDLGPALHSSSFSKTQLM
ILDDNRLMLPHWAKVVLSDIKAARYVHGIGVHWYFDRLVPPDVTLTSTHHLYPDYFLFAT
EACAGWSPVDRGVRLGSWDRAEDYAHDIIQDLNNYVTGWTDWNLALNQDGGPNWVKNFVD
SPIIVDPSKDIFYKQPTFYSMAHFSKFLWEESQRVGVSFSQQTSLEMSAFIRPDASAVLI
ILNRSEEEVPFEVWDQTVGFLPGSAPPHSILTLLWNRQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaacggctctttttattctgctcgccggaataatcaccacagcaagagctgac
agtaaagacggttgtctagcactgaatttcggtcatggctcggttgtgtgtgtgtgcaat
gcgacatactgcgactctctcggccggactgtgctgccagatgctggtcagttcttatca
tatgtcagcaataaagctggcagcagactgatggagagtcaaggacagttccagaagaac
agcacaggtgcagctctcagaatcactctgaaccccagtcagaagttccagcacattaag
ggattcgggggagccatgacggatgcagcagccattaatattttgtctctgtcttccgga
gctcaggaccagctgctcagacagtacttctccacagatggtatagagtaccgtttcgtg
agagtgccggtggccagctgtgatttttcaactcgactctacacgtatgctgacactcca
gaagactacgatctccagaacttcaccctggccaaagaggatgttcacatgaagattccc
cttctgcagcgggcacaggctctatctgctcagcctctctatctgttcgccagtgcctgg
agcgcccccgcctggctgaagaccaacggcgcactgatagggaagggctccctcaaaggc
aaaccaggaggcaaagaacacaagacctgggctcagtactatatcaggtttctagaggaa
tacaggaagtataatctttcgttctgggggctgacgtcagggaatgagcccactgcaggt
gaaatgacaaattacagttttcaggctttgggttttactccggagacgcagcgtgactgg
attgccctggatctaggtccagcactccattcctcatccttttccaagacccaactaatg
attcttgatgacaaccgccttatgctgccacattgggccaaagtggttctaagtgacatt
aaagcagcacgatatgtccacggcattggtgttcactggtattttgatcgccttgtgccg
cctgacgtcaccctgacctccacacaccatctgtaccctgattacttcctatttgcaact
gaggcatgcgctgggtggagtccagtggatcgtggtgtgcgtctgggcagctgggacagg
gcagaggactacgcccatgacatcatccaggacctgaataattatgtgaccggctggacc
gactggaatttggcccttaatcaggatggaggacccaactgggtcaagaactttgtggac
agtcccataattgtggacccaagcaaagatatattttacaagcagcccacattctacagc
atggcccacttcagcaagttcctgtgggaggagtctcagcgagtaggtgtgtcctttagt
cagcagaccagcctagaaatgtctgcattcatcagacctgacgcctcagcagtattaatc
attctaaacaggtctgaagaggaggtgccatttgaagtctgggatcaaacggtgggcttt
ttgccaggaagtgctccacctcactccattctcacactactgtggaacagacagtaa

DBGET integrated database retrieval system