KEGG   Danio rerio (zebrafish): 559072Help
Entry
559072            CDS       T01004                                 

Gene name
gba
Definition
(RefSeq) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00511  Other glycan degradation
dre00600  Sphingolipid metabolism
dre01100  Metabolic pathways
dre04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    559072 (gba)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    559072 (gba)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    559072 (gba)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     559072 (gba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glycoamylase CAP
Motif
Other DBs
NCBI-GeneID: 559072
NCBI-ProteinID: XP_687471
ZFIN: ZDB-GENE-100922-270
Ensembl: ENSDARG00000076058
Vega: OTTDARG00000033160
UniProt: E7EZM1
Position
16
AA seq 518 aa AA seqDB search
MRETALFILLAGIITTARADSKDGCLALNFGHGSVVCVCNATYCDSLGRTVLPDAGQFLS
YVSNKAGSRLMESQGQFQKNSTGAALRITLNPSQKFQHIKGFGGAMTDAAAINILSLSSG
AQDQLLRQYFSTDGIEYRFVRVPVASCDFSTRLYTYADTPEDYDLQNFTLAKEDVHMKIP
LLQRAQALSAQPLYLFASAWSAPAWLKTNGALIGKGSLKGKPGGKEHKTWAQYYIRFLEE
YRKYNLSFWGLTSGNEPTAGEMTNYSFQALGFTPETQRDWIALDLGPALHSSSFSKTQLM
ILDDNRLMLPHWAKVVLSDIKAARYVHGIGVHWYFDRLVPPDVTLTSTHHLYPDYFLFAT
EACAGWSPVDRGVRLGSWDRAEDYAHDIIQDLNNYVTGWTDWNLALNQDGGPNWVKNFVD
SPIIVDPSKDIFYKQPTFYSMAHFSKFLWEESQRVGVSFSQQTSLEMSAFIRPDASAVLI
ILNRSEEEVPFEVWDQTVGFLPGSAPPHSILTLLWNRQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaacggctctttttattctgctcgccggaataatcaccacagcaagagctgac
agtaaagacggttgtctagcactgaatttcggtcatggctcggttgtgtgtgtgtgcaat
gcgacatactgcgactctctcggccggactgtgctgccagatgctggtcagttcttatca
tatgtcagcaataaagctggcagcagactgatggagagtcaaggacagttccagaagaac
agcacaggtgcagctctcagaatcactctgaaccccagtcagaagttccagcacattaag
ggattcgggggagccatgacggatgcagcagccattaatattttgtctctgtcttccgga
gctcaggaccagctgctcagacagtacttctccacagatggtatagagtaccgtttcgtg
agagtgccggtggccagctgtgatttttcaactcgactctacacgtatgctgacactcca
gaagactacgatctccagaacttcaccctggccaaagaggatgttcacatgaagattccc
cttctgcagcgggcacaggctctatctgctcagcctctctatctgttcgccagtgcctgg
agcgcccccgcctggctgaagaccaacggcgcactgatagggaagggctccctcaaaggc
aaaccaggaggcaaagaacacaagacctgggctcagtactatatcaggtttctagaggaa
tacaggaagtataatctttcgttctgggggctgacgtcagggaatgagcccactgcaggt
gaaatgacaaattacagttttcaggctttgggttttactccggagacgcagcgtgactgg
attgccctggatctaggtccagcactccattcctcatccttttccaagacccaactaatg
attcttgatgacaaccgccttatgctgccacattgggccaaagtggttctaagtgacatt
aaagcagcacgatatgtccacggcattggtgttcactggtattttgatcgccttgtgccg
cctgacgtcaccctgacctccacacaccatctgtaccctgattacttcctatttgcaact
gaggcatgcgctgggtggagtccagtggatcgtggtgtgcgtctgggcagctgggacagg
gcagaggactacgcccatgacatcatccaggacctgaataattatgtgaccggctggacc
gactggaatttggcccttaatcaggatggaggacccaactgggtcaagaactttgtggac
agtcccataattgtggacccaagcaaagatatattttacaagcagcccacattctacagc
atggcccacttcagcaagttcctgtgggaggagtctcagcgagtaggtgtgtcctttagt
cagcagaccagcctagaaatgtctgcattcatcagacctgacgcctcagcagtattaatc
attctaaacaggtctgaagaggaggtgccatttgaagtctgggatcaaacggtgggcttt
ttgccaggaagtgctccacctcactccattctcacactactgtggaacagacagtaa

DBGET integrated database retrieval system