KEGG   Danio rerio (zebrafish): 559099Help
Entry
559099            CDS       T01004                                 

Gene name
usp30, si:dkey-72n1.2
Definition
ubiquitin specific peptidase 30 (EC:3.4.19.12)
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 491 aa AA seqDB search
MPWCKQGTTDKLVREFLRTGAAARNKMMKNWGVIGGIAAAMAAGVYVLWGPISDRRKKRK
GMVPGLLNLGNTCFMNSLLQGLAACPSFIRWLEDFTSQNSADRERTERETQLSRSLMQLL
KALSSHDPGEDDVLDAGGLLEALRLYRWHISSFEEQDAHELFHVLTSSLEEEQERQPRVA
HLFDMQTLEKSVESKEKNISCRSGGPLHPIPSLWRTRHPFHGRLTSYMACKRCEQQSPVH
YDSFDSLSLSIPSIQWGRPVTLDQCLQHFISSETIKEVECENCTKQQAGELVNGEVLESQ
RTTFVKQLKLGKRLTWSKEGSPIKRQEHVQFTEYLSLDRYKHCSAAQSQQKTSRTNKAKA
SADPKDKAIANGVDSEHCNNNKPQSNGTFPSVFLHSPGLSSQLNLTYDYSTSEYLFRLTA
VLVHHGDMHSGHFITYRRCPAAPRGTSPFSSQWLWVSDDSVRKASLQEVLSSSAYLLFYE
RMQRPGLRVEE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgccttggtgcaagcaaggaactacagacaagcttgtacgagagtttttacgcactggg
gccgctgcaaggaacaagatgatgaagaactggggcgtgattggtggaatagctgctgcc
atggctgctggagtctatgtactatgggggccaatttcagacaggaggaagaagagaaaa
ggtatggttcctggtctgcttaatctggggaacacgtgttttatgaactcacttctccag
ggtctggcagcgtgtccttccttcatccgatggcttgaagacttcacaagtcaaaacagc
gctgatcgagagagaacggaaagagaaactcagctgtccagatctctgatgcagttactt
aaagccctgtcgagtcatgatccaggagaagatgatgttttagatgccggaggccttttg
gaagcgctcagactttacagatggcacatcagctcattcgaggaacaggatgctcatgag
ctctttcatgttctcacatcatcattagaggaagaacaggaacgccaacccagagtcgct
cacctcttcgacatgcaaacactggagaaatctgtggagtccaaagagaaaaacattagt
tgtcgaagtggaggcccactgcatcctattcctagtttatggagaactaggcatcctttt
catggacggttaacaagttatatggcttgcaagcgctgcgaacaacagagtcctgtgcat
tatgactctttcgacagcttgtctctttcgatcccttcaatacagtggggtcgacctgtt
actttggaccagtgtttacagcatttcatctcctctgaaaccatcaaagaagtggaatgt
gaaaactgcaccaagcagcaggctggagagctagtaaatggagaagtgcttgagagtcag
aggacgacatttgtcaagcagctgaaacttggaaagagactgacgtggtctaaagagggc
agtcccataaagagacaggagcatgttcagtttacagaatatttatctctggatcgatac
aaacactgtagtgctgctcagagccagcagaagaccagcagaacaaataaggccaaagct
tccgcagacccaaaggacaaagccattgctaatggtgttgattcagagcactgtaataac
aacaagccacagtccaatggaactttcccctctgtctttctgcactcacctggtctaagc
tcacaacttaacctcacgtacgactacagcacctcggagtacctcttccgcttaacggcg
gtgctggttcatcatggagacatgcattcgggtcattttatcacttaccgccgctgtcct
gccgctccgcgtgggacttctccattcagctcgcagtggctgtgggtgtctgatgactct
gtgaggaaggccagtcttcaggaggtgctctcctccagtgcatatctgctcttttatgag
cgaatgcagaggcctggtctgagggtagaagagtag

DBGET integrated database retrieval system