KEGG   Danio rerio (zebrafish): 559099Help
Entry
559099            CDS       T01004                                 

Gene name
usp30, si:dkey-72n1.2
Definition
(RefSeq) ubiquitin specific peptidase 30 (EC:3.4.19.12)
  KO
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     559099 (usp30)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   559099 (usp30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 491 aa AA seqDB search
MPWCKQGTTDKLVREFLRTGAAARNKMMKNWGVIGGIAAAMAAGVYVLWGPISDRRKKRK
GMVPGLLNLGNTCFMNSLLQGLAACPSFIRWLEDFTSQNSADRERTERETQLSRSLMQLL
KALSSHDPGEDDVLDAGGLLEALRLYRWHISSFEEQDAHELFHVLTSSLEEEQERQPRVA
HLFDMQTLEKSVESKEKNISCRSGGPLHPIPSLWRTRHPFHGRLTSYMACKRCEQQSPVH
YDSFDSLSLSIPSIQWGRPVTLDQCLQHFISSETIKEVECENCTKQQAGELVNGEVLESQ
RTTFVKQLKLGKRLTWSKEGSPIKRQEHVQFTEYLSLDRYKHCSAAQSQQKTSRTNKAKA
SADPKDKAIANGVDSEHCNNNKPQSNGTFPSVFLHSPGLSSQLNLTYDYSTSEYLFRLTA
VLVHHGDMHSGHFITYRRCPAAPRGTSPFSSQWLWVSDDSVRKASLQEVLSSSAYLLFYE
RMQRPGLRVEE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgccttggtgcaagcaaggaactacagacaagcttgtacgagagtttttacgcactggg
gccgctgcaaggaacaagatgatgaagaactggggcgtgattggtggaatagctgctgcc
atggctgctggagtctatgtactatgggggccaatttcagacaggaggaagaagagaaaa
ggtatggttcctggtctgcttaatctggggaacacgtgttttatgaactcacttctccag
ggtctggcagcgtgtccttccttcatccgatggcttgaagacttcacaagtcaaaacagc
gctgatcgagagagaacggaaagagaaactcagctgtccagatctctgatgcagttactt
aaagccctgtcgagtcatgatccaggagaagatgatgttttagatgccggaggccttttg
gaagcgctcagactttacagatggcacatcagctcattcgaggaacaggatgctcatgag
ctctttcatgttctcacatcatcattagaggaagaacaggaacgccaacccagagtcgct
cacctcttcgacatgcaaacactggagaaatctgtggagtccaaagagaaaaacattagt
tgtcgaagtggaggcccactgcatcctattcctagtttatggagaactaggcatcctttt
catggacggttaacaagttatatggcttgcaagcgctgcgaacaacagagtcctgtgcat
tatgactctttcgacagcttgtctctttcgatcccttcaatacagtggggtcgacctgtt
actttggaccagtgtttacagcatttcatctcctctgaaaccatcaaagaagtggaatgt
gaaaactgcaccaagcagcaggctggagagctagtaaatggagaagtgcttgagagtcag
aggacgacatttgtcaagcagctgaaacttggaaagagactgacgtggtctaaagagggc
agtcccataaagagacaggagcatgttcagtttacagaatatttatctctggatcgatac
aaacactgtagtgctgctcagagccagcagaagaccagcagaacaaataaggccaaagct
tccgcagacccaaaggacaaagccattgctaatggtgttgattcagagcactgtaataac
aacaagccacagtccaatggaactttcccctctgtctttctgcactcacctggtctaagc
tcacaacttaacctcacgtacgactacagcacctcggagtacctcttccgcttaacggcg
gtgctggttcatcatggagacatgcattcgggtcattttatcacttaccgccgctgtcct
gccgctccgcgtgggacttctccattcagctcgcagtggctgtgggtgtctgatgactct
gtgaggaaggccagtcttcaggaggtgctctcctccagtgcatatctgctcttttatgag
cgaatgcagaggcctggtctgagggtagaagagtag

DBGET integrated database retrieval system