KEGG   Danio rerio (zebrafish): 559099Help
Entry
559099            CDS       T01004                                 

Gene name
usp30
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 30
  KO
K11851  ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    559099 (usp30)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     559099 (usp30)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   559099 (usp30)
Membrane trafficking [BR:dre04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    559099 (usp30)
Ubiquitin system [BR:dre04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    559099 (usp30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 559099
NCBI-ProteinID: NP_001155956
ZFIN: ZDB-GENE-060526-335
Ensembl: ENSDARG00000056842
Vega: OTTDARG00000016076
UniProt: A2BGT0
Position
5
AA seq 491 aa AA seqDB search
MPWCKQGTTDKLVREFLRTGAAARNKMMKNWGVIGGIAAAMAAGVYVLWGPISDRRKKRK
GMVPGLLNLGNTCFMNSLLQGLAACPSFIRWLEDFTSQNSADRERTERETQLSRSLMQLL
KALSSHDPGEDDVLDAGGLLEALRLYRWHISSFEEQDAHELFHVLTSSLEEEQERQPRVA
HLFDMQTLEKSVESKEKNISCRSGGPLHPIPSLWRTRHPFHGRLTSYMACKRCEQQSPVH
YDSFDSLSLSIPSIQWGRPVTLDQCLQHFISSETIKEVECENCTKQQAGELVNGEVLESQ
RTTFVKQLKLGKRLTWSKEGSPIKRQEHVQFTEYLSLDRYKHCSAAQSQQKTSRTNKAKA
SADPKDKAIANGVDSEHCNNNKPQSNGTFPSVFLHSPGLSSQLNLTYDYSTSEYLFRLTA
VLVHHGDMHSGHFITYRRCPAAPRGTSPFSSQWLWVSDDSVRKASLQEVLSSSAYLLFYE
RMQRPGLRVEE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgccttggtgcaagcaaggaactacagacaagcttgtacgagagtttttacgcactggg
gccgctgcaaggaacaagatgatgaagaactggggcgtgattggtggaatagctgctgcc
atggctgctggagtctatgtactatgggggccaatttcagacaggaggaagaagagaaaa
ggtatggttcctggtctgcttaatctggggaacacgtgttttatgaactcacttctccag
ggtctggcagcgtgtccttccttcatccgatggcttgaagacttcacaagtcaaaacagc
gctgatcgagagagaacggaaagagaaactcagctgtccagatctctgatgcagttactt
aaagccctgtcgagtcatgatccaggagaagatgatgttttagatgccggaggccttttg
gaagcgctcagactttacagatggcacatcagctcattcgaggaacaggatgctcatgag
ctctttcatgttctcacatcatcattagaggaagaacaggaacgccaacccagagtcgct
cacctcttcgacatgcaaacactggagaaatctgtggagtccaaagagaaaaacattagt
tgtcgaagtggaggcccactgcatcctattcctagtttatggagaactaggcatcctttt
catggacggttaacaagttatatggcttgcaagcgctgcgaacaacagagtcctgtgcat
tatgactctttcgacagcttgtctctttcgatcccttcaatacagtggggtcgacctgtt
actttggaccagtgtttacagcatttcatctcctctgaaaccatcaaagaagtggaatgt
gaaaactgcaccaagcagcaggctggagagctagtaaatggagaagtgcttgagagtcag
aggacgacatttgtcaagcagctgaaacttggaaagagactgacgtggtctaaagagggc
agtcccataaagagacaggagcatgttcagtttacagaatatttatctctggatcgatac
aaacactgtagtgctgctcagagccagcagaagaccagcagaacaaataaggccaaagct
tccgcagacccaaaggacaaagccattgctaatggtgttgattcagagcactgtaataac
aacaagccacagtccaatggaactttcccctctgtctttctgcactcacctggtctaagc
tcacaacttaacctcacgtacgactacagcacctcggagtacctcttccgcttaacggcg
gtgctggttcatcatggagacatgcattcgggtcattttatcacttaccgccgctgtcct
gccgctccgcgtgggacttctccattcagctcgcagtggctgtgggtgtctgatgactct
gtgaggaaggccagtcttcaggaggtgctctcctccagtgcatatctgctcttttatgag
cgaatgcagaggcctggtctgagggtagaagagtag

DBGET integrated database retrieval system