KEGG   Danio rerio (zebrafish): 559212Help
Entry
559212            CDS       T01004                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dre  Danio rerio (zebrafish)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    559212
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     559212
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   559212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 689 aa AA seqDB search
MAESESNISVPHLKSLLQMDPYLKPFEKDFERRYGLFEKQLAFLEEAEGGFDHFTRSYES
FGVQRLQDNSLVFKEWAPAAEALFLTGDFNGWDKFSHPYAKKEFGKWELHIPPKEDKTPA
VTHNSKLKVVVHTSAGERLYRISPWAKYVTRHEKSVIYDWVHWDPPQPYIHKHPRPQKPR
SLRIYESHVGIASPEGKIASYSNFTHNVLPRIKDLGYNSIQLMAIMEHAYYASFGYQVTS
FFAASSRYGTPEELKELIDVAHSLGIIVLLDVVHSHASKNTEDGLNLFDGSDSCFFHSGP
RGEHSLWDSRLFNYSSWEVLRFLLSNLRWWMEEYKFDGFRFDGVTSMLYHHHGIGSGFSG
DYNEYFGLQVDEDSLVYLMLANHILHTLYEDCITIAEDVSGMPTLCCPVQQGGLGFDYRL
AMAIPDKWIQILKEFKDEDWNMGNIVFTMTNRRYGEKCIAYAESHDQALVGDKTLAFWLM
DKEMYTSMSALIPMNSIIDRGIQLHKMIRLLTHSLGGEGYLNFMGNEFGHPEWLDFPRIG
NNESYHYARRQYNLVDMDHLRYRQLYAFDRDMNRTEDNYGWLAAPPAYVSVKHEGDKVIV
FERANLIFIFNFHPFNSYSDYRVAVGPAGKYKIKLDSDEIQYGGHGRLDHNTEFFTEAMG
LNNRPNSMMVYIPCRTAIVLANEEIDYCY
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatcggagagtaacatttcagttcctcacttgaaatctcttctgcaaatggat
ccctacctcaagccctttgaaaaggacttcgagaggaggtatgggctgtttgagaagcag
ctggctttcttggaggaggctgaaggaggctttgatcatttcactcgcagttatgagagt
tttggcgttcagcggctgcaggacaacagcctggtctttaaggaatgggctccggctgca
gaggctctgttcctcactggagacttcaatggctgggataagttttcccatccctacgct
aaaaaggagtttgggaaatgggagcttcacattcctccgaaagaggacaagacacctgcc
gtcactcataactccaagctgaaggtggttgttcacaccagtgcgggtgagcggctgtac
cgaatctctccttgggcaaagtatgtgaccaggcatgagaagtccgtcatctatgattgg
gtgcactgggaccctcctcaaccttacattcacaagcatccccgtccacagaagcccagg
agcttgcggatatacgagtcccatgttggcattgcttctccagagggcaaaattgcgtcc
tacagcaacttcacccacaatgtgctgccccgcatcaaagatctgggttataacagcatt
cagctgatggccatcatggagcatgcctactatgctagcttcggttaccaggtcacgagt
ttttttgcagcatcaagccgttacgggaccccggaggagctgaaggagctgattgacgtg
gctcattctctcggcatcatcgtcctgcttgatgtggtgcacagccacgcgtccaaaaac
acagaggacggcctgaacctgtttgacggctccgactcctgcttcttccacagcgggccc
cgtggagaacacagcctgtgggacagcagactcttcaactactccagctgggaggtgttg
cgttttctcctgtcgaacttgcgctggtggatggaggagtacaagtttgatggattcagg
ttcgacggagtcacatccatgctctaccatcatcacggcatcggatctggattttctggg
gattataacgagtactttggcctgcaggtggatgaggactctctggtctacctgatgttg
gcgaaccatattttacacactctctatgaagactgcatcactatcgctgaggatgtgtcc
gggatgcctacactttgctgtccagtccaacaaggaggtctgggttttgactaccgcctg
gccatggccattccagacaaatggattcaaatcctcaaggaattcaaggacgaagactgg
aacatgggaaacattgtgtttacgatgaccaacaggcgatatggagagaaatgcattgct
tacgccgagagccatgaccaggcactggtgggagacaaaacgctggccttctggctgatg
gacaaagagatgtacaccagcatgagcgctttgattcccatgaactccattattgatcgg
ggcatccagcttcataagatgatccgactgcttacccacagcctgggaggagagggatac
ctcaacttcatgggcaatgagtttggccatccagagtggctggattttccacgaatcggc
aataatgagagttatcattatgcccgccggcagtataacctggtggacatggatcatctg
cgctaccggcagctgtacgcttttgaccgagacatgaaccgcacggaggacaactacggc
tggctggctgctccaccggcatacgtcagtgtcaagcatgagggtgacaaggtgatcgta
ttcgagagagcaaacctcatcttcatcttcaacttccaccctttcaacagctacagcgac
tacagggtggccgtggggccggcggggaaatataaaatcaagctggactctgatgagatc
caatatggaggccatggcagactggatcacaatactgagttcttcactgaggcaatggga
cttaacaatcggccaaactctatgatggtttacattccctgcagaaccgctattgttctg
gccaacgaggaaatcgattactgctactga

DBGET integrated database retrieval system