KEGG   Danio rerio (zebrafish): 559240Help
Entry
559240            CDS       T01004                                 

Gene name
gba2
Definition
glucosidase, beta (bile acid) 2
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dre  Danio rerio (zebrafish)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dre00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dre00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
7
AA seq 851 aa AA seqDB search
MDLNDSKSLAELMSRYASSETGFGVPKDGWRICLAHEFKEKRKPFQAKDVSLSNMLEHVS
LGVRYLKWWYRKTQVEKKAPFIDMFRAVPLRQIYGVPLGGIGGGSITRGWRGEFCRWQLN
PGMYHYKTVIANQFTVCLRRDGQTVYQQVLSTERPSTLQGWNWGYCGEHAFYHGLFPRAW
TVYNLPGQNVTLTCRQVSPVIPHDYKDSSLPVAVFVWDIENKNDYALDISIMFTMVNGSG
QKDDKSGGHWNEPFHLEKEGESVSGVLLHHQTPANPYTLCIAARQKSGQEISHQTAFSPK
GTCSAVWCDLMTDGRLDSPTNSSPPTEKGEEVAAALVVSCSVSANSRNSVDFSLAWDMPK
ITFGSKERTYVRRYTRYYGTKGDAAPSISHYALTHYSKWEESIEEWQRPILQDRSLPAWY
KSALFNELYFVVDGGTIWVELPEDADISGGLRPEDGGLPAQPEVVKDFGRFAYLEGQEYR
MYNTYDVHFYASFALIMLWPKLALSLQYDIAGSVVQHDPMERLNLMNGRYSPVKTRGVVP
HDIGDPDDEPWVRVNAYLIHDTADWKDLNLKFVLQVYRDYHLTQDQQYLKDMWPVCQTVM
ENELKFDKDGDGLIENSGYADQTYDGWKVTGPSAYCGGLWLASVCMMCKMARVLNCESVY
QRYRDILERGSAAFDKLLWNGKYYNYDSSGRSLSNSVMSDQCAGHWFLRASGLGDDEYQA
FPKEKICSALKSVFDLNVMSFAGGQMGAVNGMRPEGVPDRSSVQSDEVWVGVVYGLAATM
IHEGMVEEGLRTAEGCYRAVWERMGMAFQTPEAYCEKGIYRSLAYMRPLSIWAMQLALNN
RPNHDTTTDKT
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaatgacagcaagtctctggccgagctgatgagccgatatgcgtcttcagaa
actggattcggtgtccccaaggatggctggcgcatatgcctggcgcacgagttcaaagag
aagcgcaaaccgtttcaagccaaagatgtgtcattgtccaacatgctcgagcatgtttct
ttaggtgtcaggtaccttaaatggtggtaccgaaagacccaggttgagaagaaggctcct
ttcattgatatgtttcgggctgtgccactgagacagatttatggcgttcctcttggtggc
attggcggagggagcatcactcgtggatggagaggagagttctgccgctggcaactaaat
cctggaatgtaccactacaaaaccgttattgctaatcagtttacagtgtgtctgcgaagg
gatggccagactgtgtaccagcaggttttgtctacagaacgaccttcgactttacagggc
tggaactggggttattgtggtgaacatgccttttaccatggccttttcccacgagcctgg
acagtctacaacctgcccggccagaacgtcactctcacctgcagacaggtgtcgcctgtt
atccctcacgactacaaggactccagtcttcctgtggctgtgtttgtgtgggacattgag
aataagaatgattatgcgcttgacatttctattatgttcaccatggtcaacgggtccggc
caaaaagatgacaagagtgggggccactggaatgaaccatttcaccttgagaaagaggga
gaatccgtgtctggggttttactacaccaccagacgcctgcaaacccttacacactgtgc
atagctgcgagacagaagtctggccaggagatcagtcaccagactgcgttcagtccaaag
ggaacgtgcagtgctgtgtggtgtgaccttatgactgacgggcgacttgactcgcccaca
aactccagtccacccacagagaagggggaagaagtggcagcagctctggtggtcagctgc
tctgtgtctgctaacagtcgcaacagtgtggacttcagcttggcctgggacatgcctaaa
atcacatttggctccaaagagagaacatatgtgaggagatacacacgctattatggtacc
aaaggagatgcggccccgtctatttcccactacgcgctcacacactacagtaaatgggag
gagagcattgaagagtggcagaggccgattctgcaggacaggtctcttccagcgtggtat
aaatctgctctgtttaatgagctctattttgttgtggacggtggaacaatatgggtggag
cttccggaagatgctgatatcagcggtgggcttcgtcctgaggatggagggcttccagca
cagcctgaagttgtcaaagattttggtcgttttgcttacctagagggtcaagagtacagg
atgtataacacatatgatgtccatttctatgcttcattcgctctcatcatgctctggcca
aagctggctctgagtctacagtatgatatcgcgggtagtgttgttcagcatgaccccatg
gagaggctgaatctaatgaatggcagatattcgccagtcaagactcgaggtgttgtacca
cacgacatcggagacccggacgatgagccatgggttcgtgtcaacgcttatttgatccat
gacacggctgactggaaggacttgaacctgaagtttgtgctgcaggtgtacagggactat
catctgacccaggaccagcagtatctgaaggacatgtggcccgtgtgccagaccgtgatg
gaaaacgagttgaagtttgataaggacggcgatggcctgatagaaaactctggatatgca
gaccagacctatgatggatggaaggtgactggacccagtgcgtactgtggtggtctgtgg
ctggcgtctgtgtgcatgatgtgtaaaatggcacgtgtgctaaattgcgagtctgtttat
caacgctacagagatattttggagagaggaagtgcagcctttgacaaactcctctggaat
ggcaagtactataattatgacagcagtgggcggagtctgtctaacagtgtgatgtcagat
cagtgcgcaggccattggttcctcagggcatctggactgggagatgatgaataccaggca
tttccaaaggagaagatctgcagtgcgctgaagtcagtgtttgacctgaacgtgatgagt
tttgctggtgggcagatgggggcagtgaacggcatgaggccagaaggtgttcctgaccgc
tccagcgttcaatcagacgaggtgtgggtgggtgtggtctatggactggcagctacaatg
atacatgaaggtatggtggaggagggcctgcgcactgcagagggctgttatcgagctgta
tgggagcgaatgggaatggccttccagacacccgaagcctactgcgagaagggcatctac
cgttctctggcttacatgaggcctctgagcatatgggcaatgcagctggcactcaacaat
cggccaaaccacgacacaaccactgataaaacctga

DBGET integrated database retrieval system