KEGG   Danio rerio (zebrafish): 559273Help
Entry
559273            CDS       T01004                                 

Gene name
ep300a, gb:dq017643, im:7158255
Definition
(RefSeq) E1A binding protein p300 a
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    559273 (ep300a)
   04330 Notch signaling pathway
    559273 (ep300a)
   04350 TGF-beta signaling pathway
    559273 (ep300a)
   04068 FoxO signaling pathway
    559273 (ep300a)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    559273 (ep300a)
  Cellular community - eukaryotes
   04520 Adherens junction
    559273 (ep300a)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    559273 (ep300a)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    559273 (ep300a)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     559273 (ep300a)
Transcription factors [BR:dre03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    559273 (ep300a)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    559273 (ep300a)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    559273 (ep300a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
12
AA seq 2682 aa AA seqDB search
MAENVLDSGPPSAKRPKLSSPALSASASDGNDFGSLFDLEHDLPDELISSSELSLANGGD
LGQLHTSLGSGGGVIGGAVSGGQDAAAKHRQLSELLRHGSTPGAQQQGAMGNPGGASMGL
FGNMKVSPGTQSMGPQGQQHLSMQAGLMQQQQMVDYLNRNMLGPQKGNGQQQPGGPAPQH
QNALASQMMNGSPRIGHHNPGMGNSNSNLLAEALQQQQQQTVGSQGGLRPQQPGAISKMG
INAGSGPYGGPYGQSASQGLGVAGLAPQLQNKPGLPNSPAQFNLDKKPLPIHGIPGMQAS
QSSPVGAGGGGVAAGMVPNAQGSLGPGSAGSVVSAAVVGGVPPAADPEKRKLIQQQLVLL
LHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKN
CTRHDCPVCLPLKNAGDKRNQQSESMIATGGVALSSSMGNVTGGSPSAPSLNTPGQIDPS
SIERAYAALGLTYQGNQAPPQPIQQTQRPVNTLGANSMGVNGAVGGQPQNQQSSLLQDTM
LHLNMNSQSLINDSGVGSLPMANPAASGSMRKSWHEDITQDLRNHLVHKLVQAIFPTPDP
AALKDRRMENLVAYARKVEGDMYESANSRAEYYHFLAEKIYKIQKELEEKRRTRLQKQGI
MPSQAGMNPSGLQQATAGIGQPGPPTGLPSNGPLSDPSVVRPTGPNQMMNRMQNTAGMNS
FGNHMGMQSMGQRSTPPLNQGSMVPGRMPQPNVAQMQNQYMQTGPFQASSPVRSAGPVDL
VHGGNDGAATQQGQMPLSSLPVGSPLAQPGSAGGAGSGSSVGSLGPSSMSAVPPSSTPTH
SISLSHCPPVHQNSPSPAHSRTPTPTPGSQTPQPHTPSLPHLSSNGSQQQFPPSASSDSG
MQPLGTPPAVSHSGLSTPNASQHPRTPLSHKGSLPVDGQAATPASVSSVEASFQQAPSDS
TATLEPKVEVKAKDEEEEEAMEEERTAKEEDSKTEEKPEVKKEEPLSDGGPMETASDEDK
KPEIKIEPKEEEEGSESATSQSSVSGATNKKKIFKPEELRQALMPTLESLYRQDPESLPF
RQPVDPSLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKT
SRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFSYQ
NSSPKYGLLADRYHFCEKCFNEIQGETVSLGDDPSQPQTATIFLNISRSINKDQFEKKKN
DTLDPELFVECMDCGRKMHQICVLHNETIWPSGFVCDGCLKKSNKTRKENKYAAKRLPQT
KLGNFLETRVNAYLKRQNHPESGEVTVRVVHVSEKMVEVKPGMKSRFVDSGEMSESFPYK
SKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFQPRFLRTEVYHE
ILIGYLDYAKRQGFTTGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKAVA
ERVVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENSTSN
ESVETTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVF
FVIRLFAAPNSNALLPIVDPDPLMACDLMDGRDAFLTIARDKHLEFSSLRRSKWSTMCML
VELHNQSQDRFVYTCNECKHHVETRFHCTVCEDYDLCITCYNTKGHEHKMDKLGLGLDDE
SNSQVASTTQNPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKT
NGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMVRRRMASM
QRTGQQLPGGGCGLPSPGNGCNTGPSTPTPSTQPPTPQTPTQQCQPPATQPGVGNVPSQQ
QQQLAGMTHQYQPISGSGGMINSSQQSMLPQQQQQPTPAQHLQNANNLPPYVQRPTGSSP
LSQSMGKPGMVPGGFSQQQQSNLGQPVMPQHQPPGPPPAAVEIAMKIQRVAETQRQMAQQ
KILQRNQAPGMMPPHGLHQGPQTQNQMGINLPGTAMVGPSQAQVAVARTQMDQQQGMVTA
GMQQQQPGPRSQLPQVQLQQGQQGAPQLQVSPQQQWTGPGMPPQQRPGVMNQMGLQGMAA
PQHQQQQAVGQSQPQGNSGVMGMISSQGGAAPAGAGPGNHSQAALQDLLRFLRLPSSPHQ
QQQVLSILRSNPLLMATFIRQRAPRYLGRGGPGAGGAGVPGGPGGGPGIMDGQQMNVNPN
AAQGGMHMTQGTTMQMNPLQQQQQQQQIQQRPMMSGNLQQQQQMAVLQQQQQQGVMPSQG
TNISNIPPQLREMMRRHLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHQQMGNHAQFQHP
QPPQQQGYLGQSGIPPQQPGQPHPGGLQQQQGGAQPGTQQNYSGSVSHQQVAAALQHRLQ
QQQLQMQQQQSAMGGYQGADGGPGGGGPLQQQQQQMQSAPMGSQPQMFQQAIQQRLLQQQ
QSHLGGGSPAQHNPMSPQQSQQQMSQSPHLQGQLPNSLGNQVRSPQPSPRPQSQPPNSSP
SPRLQPQPSPHHISPQTGSPHPGHLPQHHSGMAAPPPPQQQAQASQQQQQVNAMDQGPFG
ADQNAMLSQLSGMGALHGQGTNDMLTNNQDMGSNINHSLDLM
NT seq 8049 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacgttctggactctggcccgccttcagccaagaggcctaaactctcatcc
ccggctctctccgcctcagccagcgatggaaacgattttggctctctttttgacctggag
catgaccttccagacgagctgatcagttcctcagaactgagtcttgcaaatggaggggac
ctcggccagttgcacaccagtttgggtagtgggggcggagtcattggaggagctgtgtcc
ggtggtcaggatgcagcagccaagcacaggcagctctctgagcttctccgacatggatcc
acacctggagcgcagcagcagggtgcgatgggtaacccaggaggagcctcaatgggactt
tttgggaatatgaaggtttctccgggtacccaaagcatgggtccacaaggacagcaacat
ctttccatgcaggctggcctcatgcagcagcagcagatggtggactatcttaacaggaat
atgctcggaccacagaaaggaaatggacagcagcagccaggagggcccgcacctcaacac
caaaatgcgctggcgtctcagatgatgaatggatcgcccagaataggacatcacaacccg
ggcatgggtaacagcaacagtaacctgttagcagaggctcttcagcagcagcagcagcag
acagtaggaagccagggtggactgaggccacagcagcctggagcgataagcaagatgggg
ataaatgcaggttcaggcccctatggaggcccgtatggtcagtctgccagtcagggtctt
ggtgttgcagggctggcccctcagctccagaacaaaccaggtctgcctaacagtcccgcg
cagtttaatcttgacaagaagcctctgcccatacatggcatacctggcatgcaggcctct
cagtcttccccagtgggtgctggtggaggtggagttgcggctggcatggtgcctaacgcc
caaggatctctcggccctggatcagcaggctctgttgtgtctgcagcagtggtgggaggt
gttcctccagcggcagatccagaaaagcgcaaactcatacagcaacagctggtgcttttg
ctccacgctcacaagtgccagcgaagggaacaggctaatggggaagtacggcagtgtaat
ttaccccactgccgcaccatgaagaacgtcctcaaccacatgacgcactgccaggctggc
aaatcctgccaagtggcgcactgtgcctcatccagacagataatctctcactggaagaac
tgcacacggcacgactgccctgtgtgtctgcctttgaaaaatgcaggagacaagaggaat
cagcagagtgagtctatgatagccactggaggtgtggcgttaagttcttccatgggcaat
gtaactggtggttcacccagtgcccccagtctcaataccccagggcagatagaccccagc
tccatcgagagggcatatgcagccttgggtctcacataccagggaaaccaggctccccct
caacctatacagcaaacacagcggccggtgaacaccttgggagcgaattccatgggagtg
aatggggcagttggtggccagcctcagaatcagcaatctagccttctccaggatacaatg
ctgcatctgaacatgaattcacaaagtctgataaatgacagtggtgtggggtctctgcca
atggccaacccagctgccagcggtagcatgaggaagagctggcatgaggacatcacccag
gatctgcgcaaccacctggtacacaagctagtccaggctatttttcccacaccagaccct
gctgcactgaaagaccgtcggatggagaatctagtggcctatgcacgtaaagttgagggt
gacatgtatgagtctgctaacagcagggcggagtattatcactttctggcagagaagatc
tataaaattcagaaagaactggaagagaagcgaaggacacggttacagaagcagggtata
atgccctcccaggctggcatgaacccctctggcctgcagcaagcgaccgctgggattggt
cagcctgggccacccacaggactgccttctaatggcccactatcagatccatcagtagtg
cgtccaactggcccaaaccagatgatgaacagaatgcagaatactgctgggatgaattca
tttgggaatcatatgggaatgcagtccatgggccagagatcaacaccacctcttaaccag
ggaagcatggtgcctgggaggatgccacagccgaatgttgcacagatgcaaaatcaatac
atgcaaactggaccgtttcaagcttcaagtcctgttcgtagtgctggtcctgttgaccta
gtacacggaggaaacgatggtgctgccactcaacagggacaaatgccgttatcatcttta
ccagtcgggagtcctttagcccaacctgggtctgctggcggggcaggcagcgggtcatct
gtgggctccttgggtcccagcagcatgagtgctgttcctccatcatccacccccacccac
tccatcagcctcagtcactgcccacctgtacaccagaattcaccttcaccagctcatagc
cggacgcccacacccacgccaggctcccaaacgcctcagccccacacacccagcttaccc
catttatcctcaaatggcagtcagcaacagtttcctccgtccgccagctctgacagcggc
atgcagccattaggaactcctccagcggtgtctcacagtggtctctccacaccaaatgcc
agccagcatccccgcactccattgtctcataaaggttctctaccagttgatggccaggcc
gctactcctgcctccgtcagcagtgtagaggcatcatttcagcaagctccttcagactcc
acagccaccctggagccaaaggtggaggtcaaggcgaaagatgaggaggaggaagaagcc
atggaggaagaaagaactgctaaggaggaagacagtaaaactgaggaaaagccagaggta
aagaaagaggagccattgagtgatggtgggccgatggagactgcatctgatgaggacaaa
aaacctgagataaagattgagcctaaagaagaggaagagggttcagagtccgcaactagc
cagagttctgtttctggagccactaacaaaaagaaaatttttaaaccagaggaactgagg
caggccctgatgcctacactggagtctctttaccgccaggaccctgagtctctgcccttc
cgccagcctgtagacccttcactgttgggaataccagactattttgacattgtgaaaaat
ccaatggacttgtctactatcaaacgaaagcttgacacaggccagtaccaggagccatgg
cagtatgtagatgacatctggcttatgttcaacaacgcctggctgtacaatcgtaagaca
tcacgggtctacaagtactgctccaaactggcggaggtctttgagcaagaaattgaccca
gtcatgcagagccttggctactgttgtgggagaaagcttgaattttctccccaaactctg
tgctgctatgggaaacagttatgcactataccacgagatgctgcttactttagttatcag
aacagttcaccaaaatatgggcttcttgctgacaggtaccacttctgcgagaagtgtttc
aatgagatccagggtgaaaccgtgtccttgggagacgatccatcccaacctcaaacagct
acaattttcctgaatatttctagatcaatcaacaaagatcagtttgaaaagaagaaaaat
gacacacttgaccctgagctatttgtggaatgtatggattgtggccgtaagatgcatcag
atctgcgttttgcacaatgaaactatatggccatcaggctttgtgtgtgatggttgtctg
aagaagtccaacaaaacccgcaaagagaataaatatgctgctaaaaggcttccacagacc
aaattaggcaattttttggaaacgcgggtaaatgcctatctgaagcgacaaaatcatcca
gaatctggtgaagtcactgttcgtgttgttcatgtctcagaaaaaatggtggaagtcaaa
ccaggcatgaagtctaggtttgtggatagtggagaaatgtcagagtctttcccatacaaa
tcgaaagctttatttgcgtttgaggagattgatggtgttgatgtttgcttctttgggatg
catgtgcaagagtatggctcagactgtccaccacctaatcaaagacgggtttacatatcc
tatttggacagtgtccacttctttcagccacgctttttaagaacagaggtgtaccatgaa
atccttataggatatcttgattatgccaaaagacaagggtttaccacaggacacatctgg
gcctgccctcctagcgaaggagatgattacatcttccattgtcatcctgcagaccagaag
atacccaagcccaagcgactgcaagagtggtataagaagatgctggacaaagctgtcgca
gagcgtgttgtgcatgattacaaggacatcttcaaacaggcaacagaagatcgtctcact
agtgccaaagaactgccctattttgagggtgatttctggcctaatgttcttgaagaaagc
attaaagaattggagcaagaagaagaggaaagaaagagggaggaaaacagcacatccaat
gagagtgttgagacaacaaaaggtgacagcaaaaatgccaagaaaaagaacaacaagaag
acgagcaagaacaagagcagtttaagccgaggaaacaaaaagaagcctggaatgccaaat
gtgtctaatgacctttcacagaagctctatgccacgatggaaaagcacaaagaggtgttc
tttgttatccggctgtttgcagcacccaattctaatgctcttctgcccattgttgacccg
gatcccttgatggcctgtgatttgatggatggtcgcgatgccttcctaacaattgcacga
gacaagcacttggagttttcctcattgcgacgttccaaatggagcactatgtgcatgctg
gtagaactgcacaaccaaagccaggaccgctttgtctatacctgtaatgagtgcaaacac
catgttgaaactcgcttccattgcactgtgtgcgaggactatgatctctgcatcacttgc
tacaatacaaaaggtcatgagcacaagatggacaaactgggcttggggttggacgacgaa
agcaacagtcaggttgcttccacaacacagaatccaggagactcacggcgtctcagcatt
cagcggtgcatccagtctctggtgcatgcctgccagtgtcgcaatgccaactgctcactt
ccatcttgccaaaaaatgaaacgtgtagttcagcataccaaaggctgcaaacgcaagacc
aatggtggttgtcctatctgcaagcagctcattgcgctttgttgttaccatgcaaaacac
tgccaagagaacaaatgtcctgtgccgttctgcctcaacatcaagcagaaactgcggcaa
cagcaactccagcacaggctacagcaggcccagatggtgcgtagaagaatggccagtatg
caaaggacaggccaacagcttccaggaggtggttgtggtctgccatctcctgggaacggc
tgtaatactggtccgagcactccaacaccgagcactcagccacctacccctcagacgccc
actcagcaatgtcagcctccagcaactcaacctggtgttggcaatgttccatcacagcag
caacagcagttggcagggatgacccatcagtaccagccaatatctggaagtggtgggatg
attaactcctcacagcagtcaatgttaccacagcagcagcaacagccaacaccagctcag
catctccagaatgccaacaaccttcctccatatgtgcaaagacctacaggctcatctcca
ctttctcagtcaatgggaaagccaggcatggttccaggtggcttctctcaacagcaacaa
tcaaacctagggcagcctgtgatgccacaacatcagccacctggccccccacctgcagct
gtagaaattgccatgaaaattcagcgagtcgctgagacacaacgacagatggctcagcaa
aagatcctgcaaagaaaccaggctcctggcatgatgcctccccatggcttacatcagggt
ccgcaaactcaaaaccagatgggcataaaccttcctggcactgcaatggttgggccttcc
caggcacaagtagcagtggctcgaactcaaatggatcaacagcagggaatggtcacagca
ggcatgcaacagcagcagccaggacctcggtctcagcttccccaagtccagttgcagcag
ggccagcaaggagcacctcaacttcaggtgtcaccacaacagcagtggactggtcctggc
atgcctcctcaacagagaccaggggtaatgaaccaaatgggtctgcaagggatggctgca
ccacaacatcagcagcagcaagctgttggtcaatcgcagccgcaaggaaactctggtgta
atgggtatgataagtagccaaggaggggctgcacctgcaggcgctggtcctggaaatcac
tctcaggctgccttacaagaccttttaaggttcttaagattacccagctctccccatcaa
cagcagcaagtcctgagtatactacgttcaaaccctctactcatggcaacctttataagg
caacgggctcctaggtaccttggtcgaggtggtcctggagcaggaggtgcaggtgttcca
ggtggacctggtggaggtccaggcatcatggatggccagcaaatgaatgtaaatcccaat
gcagctcagggtggtatgcacatgacacaaggaacgaccatgcaaatgaatccacttcaa
caacaacaacagcagcagcaaattcaacagcgtcctatgatgagtggaaatttgcagcag
caacagcaaatggcagtattacagcagcagcagcaacaaggtgttatgcccagtcaaggc
acgaacatctctaatatccctccccagttaagggaaatgatgagacggcatttgcagcag
cagcagcaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaa
caacaacaacagcagcagcagcatcaacagatgggtaaccatgctcaattccagcatcct
caaccaccccagcagcagggttatctaggccagtctggaattcctcctcagcagccaggc
caacctcacccaggtggtctccagcaacaacagggaggggcccagcctggaacccagcaa
aactactctgggtctgtgtcccatcagcaggttgcagcagctttgcaacataggttacag
caacagcaacttcaaatgcaacagcagcagagtgctatgggaggatatcaaggtgctgat
ggaggacctggaggtggtggtcccctccagcagcagcagcagcagatgcagtcagctcct
atgggctcacagccgcaaatgtttcagcaagctatacagcaacggctcctacagcagcaa
cagtcacacctcggaggaggatctcctgctcaacacaatcctatgagtccacagcagtcc
cagcaacagatgtcccagtctccccatttacagggccagttgcccaattctctcggcaac
caagttcgctctccccaaccatcacctcgtccccagtcccagccaccaaactctagtcca
tctcctcgcttgcagccccagccgtcaccccatcacatctcaccccagactgggtcgccc
cacccaggtcaccttcctcaacaccacagtggcatggctgctcctccaccgccacagcaa
caagcacaggcatcccagcagcagcaacaggttaacgccatggaccagggcccatttgga
gcagaccagaatgctatgctttcacagttaagcgggatgggagccttacatgggcaggga
acaaatgacatgctgacgaataaccaggatatgggctcgaacattaatcactcgttggat
ttgatgtaa

DBGET integrated database retrieval system