KEGG   Danio rerio (zebrafish): 559273Help
Entry
559273            CDS       T01004                                 

Gene name
ep300a, gb:dq017643, im:7158255
Definition
E1A binding protein p300 a
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    559273 (ep300a)
   04330 Notch signaling pathway
    559273 (ep300a)
   04350 TGF-beta signaling pathway
    559273 (ep300a)
   04630 Jak-STAT signaling pathway
    559273 (ep300a)
   04068 FoxO signaling pathway
    559273 (ep300a)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    559273 (ep300a)
  Cellular commiunity
   04520 Adherens junction
    559273 (ep300a)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    559273 (ep300a)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    559273 (ep300a)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     559273 (ep300a)
Transcription factors [BR:dre03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    559273 (ep300a)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    559273 (ep300a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Position
12
AA seq 2663 aa AA seqDB search
MAENVLDSGPPSAKRPKLSSPALSASASDGNDFGSLFDLEHDLPDELISSSELSLANGGD
LGQLHTSLGSGGGVIGGAVSGGQDAAAKHRQLSELLRHGSTPGAQQQGAMGNPGGASMGL
FGNMKVSPGTQSMGPQGQQHLSMQAGLMQQQQMVDYLNRNMLGPQKGNGQQQPGGPAPQH
QNALASQMMNGSPRIGHHNPGMGNSNSNLLAEALQQQQQQTVGSQGGLRPQQPGAISKMG
INAGSGPYGGPYGQSASQGLGVAGLAPQLQNKPGLPNSPAQFNLDKKPLPIHGIPGMQAS
QSSPVGAGGGGVAAGMVPNAQGSLGPGSAGSVVSAAVVGGVPPAADPEKRKLIQQQLVLL
LHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKN
CTRHDCPVCLPLKNAGDKRNQQSESMIATGGVALSSSMGNVTGGSPSAPSLNTPGQIDPS
SIERAYAALGLTYQGNQAPPQPIQQTQRPVNTLGANSMGVNGAVGGQPQNQQSSLLQDTM
LHLNMNSQSLINDSGVGSLPMANPAASGSMRKSWHEDITQDLRNHLVHKLVQAIFPTPDP
AALKDRRMENLVAYARKVEGDMYESANSRAEYYHFLAEKIYKIQKELEEKRRTRLQKQGI
MPSQAGMNPSGLQQATAGIGQPGPPTGLPSNGPLSDPSVVRPTGPNQMMNRMQNTAGMNS
FGNHMGMQSMGQRSTPPLNQGSMVPGRMPQPNVAQMQNQYMQTGPFQASSPVRSAGPVDL
VHGGNDGAATQQGQMPLSSLPVGSPLAQPGSAGGAGSGSSVGSLGPSSMSAVPPSSTPTH
SISLSHCPPVHQNSPSPAHSRTPTPTPGSQTPQPHTPSLPHLSSNGSQQQFPPSASSDSG
MQPLGTPPAVSHSGLSTPNASQHPRTPLSHKGSLPVDGQAATPASVSSVEASFQQAPSDS
TATLEPKVEVKAKDEEEEEAMEEERTAKEEDSKTEEKPEVKKEEPLSDGGPMETASDEDK
KPEIKIEPKEEEEGSESATSQSSVSGATNKKKIFKPEELRQALMPTLESLYRQDPESLPF
RQPVDPSLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKT
SRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFSYQ
NRYHFCEKCFNEIQGETVSLGDDPSQPQTSINKDQFEKKKNDTLDPELFVECMDCGRKMH
QICVLHNETIWPSGFVCDGCLKKSNKTRKENKYAAKRLPQTKLGNFLETRVNAYLKRQNH
PESGEVTVRVVHVSEKMVEVKPGMKSRFVDSGEMSESFPYKSKALFAFEEIDGVDVCFFG
MHVQEYGSDCPPPNQRRVYISYLDSVHFFQPRFLRTEVYHEILIGYLDYAKRQGFTTGHI
WACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKAVAERVVHDYKDIFKQATEDRL
TSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENSTSNESVETTKGDSKNAKKKNNK
KTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLFAAPNSNALLPIVD
PDPLMACDLMDGRDAFLTIARDKHLEFSSLRRSKWSTMCMLVELHNQSQDRFVYTCNECK
HHVETRFHCTVCEDYDLCITCYNTKGHEHKMDKLGLGLDDESNSQVASTTQNPGDSRRLS
IQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAK
HCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMVRRRMASMQRTGQQLPGGGCGLPSPGN
GCNTGPSTPTPSTQPPTPQTPTQQCQPPATQPGVGNVPSQQQQQLAGMTHQYQPISGSGG
MINSSQQSMLPQQQQQPTPAQHLQNANNLPPYVQRPTGSSPLSQSMGKPGMVPGGFSQQQ
QSNLGQPVMPQHQPPGPPPAAVEIAMKIQRVAETQRQMAQQKILQRNQAPGMMPPHGLHQ
GPQTQNQMGINLPGTAMVGPSQAQVAVARTQMDQQQGMVTAGMQQQQPGPRSQLPQVQLQ
QGQQGAPQLQVSPQQQWTGPGMPPQQRPGVMNQMGLQGMAAPQHQQQQAVGQSQPQGNSG
VMGMISSQGGAAPAGAGPGNHSQAALQDLLRFLRLPSSPHQQQQVLSILRSNPLLMATFI
RQRAPRYLGRGGPGAGGAGVPGGPGGGPGIMDGQQMNVNPNAAQGGMHMTQGTTMQMNPL
QQQQQQQQIQQRPMMSGNLQQQQQMAVLQQQQQQGVMPSQGTNISNIPPQLREMMRRHLQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQHQQMGNHAQFQHPQPPQQQGYLGQSGIPPQQP
GQPHPGGLQQQQGGAQPGTQQNYSGSVSHQQVAAALQHRLQQQQLQMQQQQSAMGGYQGA
DGGPGGGGPLQQQQQQMQSAPMGSQPQMFQQAIQQRLLQQQQSHLGGGSPAQHNPMSPQQ
SQQQMSQSPHLQGQLPNSLGNQVRSPQPSPRPQSQPPNSSPSPRLQPQPSPHHISPQTGS
PHPGHLPQHHSGMAAPPPPQQQAQASQQQQQVNAMDQGPFGADQNAMLSQLSGMGALHGQ
GTNDMLTNNQDMGSNINHSLDLM
NT seq 7992 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacgttctggactctggcccgccttcagccaagaggcctaaactctcatcc
ccggctctctccgcctcagccagcgatggaaacgattttggctctctttttgacctggag
catgaccttccagacgagctgatcagttcctcagaactgagtcttgcaaatggaggggac
ctcggccagttgcacaccagtttgggtagtgggggcggagtcattggaggagctgtgtcc
ggtggtcaggatgcagcagccaagcacaggcagctctctgagcttctccgacatggatcc
acacctggagcgcagcagcagggtgcgatgggtaacccaggaggagcctcaatgggactt
tttgggaatatgaaggtttctccgggtacccaaagcatgggtccacaaggacagcaacat
ctttccatgcaggctggcctcatgcagcagcagcagatggtggactatcttaacaggaat
atgctcggaccacagaaaggaaatggacagcagcagccaggagggcccgcacctcaacac
caaaatgcgctggcgtctcagatgatgaatggatcgcccagaataggacatcacaacccg
ggcatgggtaacagcaacagtaacctgttagcagaggctcttcagcagcagcagcagcag
acagtaggaagccagggtggactgaggccacagcagcctggagcgataagcaagatgggg
ataaatgcaggttcaggcccctatggaggcccgtatggtcagtctgccagtcagggtctt
ggtgttgcagggctggcccctcagctccagaacaaaccaggtctgcctaacagtcccgcg
cagtttaatcttgacaagaagcctctgcccatacatggcatacctggcatgcaggcctct
cagtcttccccagtgggtgctggtggaggtggagttgcggctggcatggtgcctaacgcc
caaggatctctcggccctggatcagcaggctctgttgtgtctgcagcagtggtgggaggt
gttcctccagcggcagatccagaaaagcgcaaactcatacagcaacagctggtgcttttg
ctccacgctcacaagtgccagcgaagggaacaggctaatggggaagtacggcagtgtaat
ttaccccactgccgcaccatgaagaacgtcctcaaccacatgacgcactgccaggctggc
aaatcctgccaagtggcgcactgtgcctcatccagacagataatctctcactggaagaac
tgcacacggcacgactgccctgtgtgtctgcctttgaaaaatgcaggagacaagaggaat
cagcagagtgagtctatgatagccactggaggtgtggcgttaagttcttccatgggcaat
gtaactggtggttcacccagtgcccccagtctcaataccccagggcagatagaccccagc
tccatcgagagggcatatgcagccttgggtctcacataccagggaaaccaggctccccct
caacctatacagcaaacacagcggccggtgaacaccttgggagcgaattccatgggagtg
aatggggcagttggtggccagcctcagaatcagcaatctagccttctccaggatacaatg
ctgcatctgaacatgaattcacaaagtctgataaatgacagtggtgtggggtctctgcca
atggccaacccagctgccagcggtagcatgaggaagagctggcatgaggacatcacccag
gatctgcgcaaccacctggtacacaagctagtccaggctatttttcccacaccagaccct
gctgcactgaaagaccgtcggatggagaatctagtggcctatgcacgtaaagttgagggt
gacatgtatgagtctgctaacagcagggcggagtattatcactttctggcagagaagatc
tataaaattcagaaagaactggaagagaagcgaaggacacggttacagaagcagggtata
atgccctcccaggctggcatgaacccctctggcctgcagcaagcgaccgctgggattggt
cagcctgggccacccacaggactgccttctaatggcccactatcagatccatcagtagtg
cgtccaactggcccaaaccagatgatgaacagaatgcagaatactgctgggatgaattca
tttgggaatcatatgggaatgcagtccatgggccagagatcaacaccacctcttaaccag
ggaagcatggtgcctgggaggatgccacagccgaatgttgcacagatgcaaaatcaatac
atgcaaactggaccgtttcaagcttcaagtcctgttcgtagtgctggtcctgttgaccta
gtacacggaggaaacgatggtgctgccactcaacagggacaaatgccgttatcatcttta
ccagtcgggagtcctttagcccaacctgggtctgctggcggggcaggcagcgggtcatct
gtgggctccttgggtcccagcagcatgagtgctgttcctccatcatccacccccacccac
tccatcagcctcagtcactgcccacctgtacaccagaattcaccttcaccagctcatagc
cggacgcccacacccacgccaggctcccaaacgcctcagccccacacacccagcttaccc
catttatcctcaaatggcagtcagcaacagtttcctccgtccgccagctctgacagcggc
atgcagccattaggaactcctccagcggtgtctcacagtggtctctccacaccaaatgcc
agccagcatccccgcactccattgtctcataaaggttctctaccagttgatggccaggcc
gctactcctgcctccgtcagcagtgtagaggcatcatttcagcaagctccttcagactcc
acagccaccctggagccaaaggtggaggtcaaggcgaaagatgaggaggaggaagaagcc
atggaggaagaaagaactgctaaggaggaagacagtaaaactgaggaaaagccagaggta
aagaaagaggagccattgagtgatggtgggccgatggagactgcatctgatgaggacaaa
aaacctgagataaagattgagcctaaagaagaggaagagggttcagagtccgcaactagc
cagagttctgtttctggagccactaacaaaaagaaaatttttaaaccagaggaactgagg
caggccctgatgcctacactggagtctctttaccgccaggaccctgagtctctgcccttc
cgccagcctgtagacccttcactgttgggaataccagactattttgacattgtgaaaaat
ccaatggacttgtctactatcaaacgaaagcttgacacaggccagtaccaggagccatgg
cagtatgtagatgacatctggcttatgttcaacaacgcctggctgtacaatcgtaagaca
tcacgggtctacaagtactgctccaaactggcggaggtctttgagcaagaaattgaccca
gtcatgcagagccttggctactgttgtgggagaaagcttgaattttctccccaaactctg
tgctgctatgggaaacagttatgcactataccacgagatgctgcttactttagttatcag
aacaggtaccacttctgcgagaagtgtttcaatgagatccagggtgaaaccgtgtccttg
ggagacgatccatcccaacctcaaacatcaatcaacaaagatcagtttgaaaagaagaaa
aatgacacacttgaccctgagctatttgtggaatgtatggattgtggccgtaagatgcat
cagatctgcgttttgcacaatgaaactatatggccatcaggctttgtgtgtgatggttgt
ctgaagaagtccaacaaaacccgcaaagagaataaatatgctgctaaaaggcttccacag
accaaattaggcaattttttggaaacgcgggtaaatgcctatctgaagcgacaaaatcat
ccagaatctggtgaagtcactgttcgtgttgttcatgtctcagaaaaaatggtggaagtc
aaaccaggcatgaagtctaggtttgtggatagtggagaaatgtcagagtctttcccatac
aaatcgaaagctttatttgcgtttgaggagattgatggtgttgatgtttgcttctttggg
atgcatgtgcaagagtatggctcagactgtccaccacctaatcaaagacgggtttacata
tcctatttggacagtgtccacttctttcagccacgctttttaagaacagaggtgtaccat
gaaatccttataggatatcttgattatgccaaaagacaagggtttaccacaggacacatc
tgggcctgccctcctagcgaaggagatgattacatcttccattgtcatcctgcagaccag
aagatacccaagcccaagcgactgcaagagtggtataagaagatgctggacaaagctgtc
gcagagcgtgttgtgcatgattacaaggacatcttcaaacaggcaacagaagatcgtctc
actagtgccaaagaactgccctattttgagggtgatttctggcctaatgttcttgaagaa
agcattaaagaattggagcaagaagaagaggaaagaaagagggaggaaaacagcacatcc
aatgagagtgttgagacaacaaaaggtgacagcaaaaatgccaagaaaaagaacaacaag
aagacgagcaagaacaagagcagtttaagccgaggaaacaaaaagaagcctggaatgcca
aatgtgtctaatgacctttcacagaagctctatgccacgatggaaaagcacaaagaggtg
ttctttgttatccggctgtttgcagcacccaattctaatgctcttctgcccattgttgac
ccggatcccttgatggcctgtgatttgatggatggtcgcgatgccttcctaacaattgca
cgagacaagcacttggagttttcctcattgcgacgttccaaatggagcactatgtgcatg
ctggtagaactgcacaaccaaagccaggaccgctttgtctatacctgtaatgagtgcaaa
caccatgttgaaactcgcttccattgcactgtgtgcgaggactatgatctctgcatcact
tgctacaatacaaaaggtcatgagcacaagatggacaaactgggcttggggttggacgac
gaaagcaacagtcaggttgcttccacaacacagaatccaggagactcacggcgtctcagc
attcagcggtgcatccagtctctggtgcatgcctgccagtgtcgcaatgccaactgctca
cttccatcttgccaaaaaatgaaacgtgtagttcagcataccaaaggctgcaaacgcaag
accaatggtggttgtcctatctgcaagcagctcattgcgctttgttgttaccatgcaaaa
cactgccaagagaacaaatgtcctgtgccgttctgcctcaacatcaagcagaaactgcgg
caacagcaactccagcacaggctacagcaggcccagatggtgcgtagaagaatggccagt
atgcaaaggacaggccaacagcttccaggaggtggttgtggtctgccatctcctgggaac
ggctgtaatactggtccgagcactccaacaccgagcactcagccacctacccctcagacg
cccactcagcaatgtcagcctccagcaactcaacctggtgttggcaatgttccatcacag
cagcaacagcagttggcagggatgacccatcagtaccagccaatatctggaagtggtggg
atgattaactcctcacagcagtcaatgttaccacagcagcagcaacagccaacaccagct
cagcatctccagaatgccaacaaccttcctccatatgtgcaaagacctacaggctcatct
ccactttctcagtcaatgggaaagccaggcatggttccaggtggcttctctcaacagcaa
caatcaaacctagggcagcctgtgatgccacaacatcagccacctggccccccacctgca
gctgtagaaattgccatgaaaattcagcgagtcgctgagacacaacgacagatggctcag
caaaagatcctgcaaagaaaccaggctcctggcatgatgcctccccatggcttacatcag
ggtccgcaaactcaaaaccagatgggcataaaccttcctggcactgcaatggttgggcct
tcccaggcacaagtagcagtggctcgaactcaaatggatcaacagcagggaatggtcaca
gcaggcatgcaacagcagcagccaggacctcggtctcagcttccccaagtccagttgcag
cagggccagcaaggagcacctcaacttcaggtgtcaccacaacagcagtggactggtcct
ggcatgcctcctcaacagagaccaggggtaatgaaccaaatgggtctgcaagggatggct
gcaccacaacatcagcagcagcaagctgttggtcaatcgcagccgcaaggaaactctggt
gtaatgggtatgataagtagccaaggaggggctgcacctgcaggcgctggtcctggaaat
cactctcaggctgccttacaagaccttttaaggttcttaagattacccagctctccccat
caacagcagcaagtcctgagtatactacgttcaaaccctctactcatggcaacctttata
aggcaacgggctcctaggtaccttggtcgaggtggtcctggagcaggaggtgcaggtgtt
ccaggtggacctggtggaggtccaggcatcatggatggccagcaaatgaatgtaaatccc
aatgcagctcagggtggtatgcacatgacacaaggaacgaccatgcaaatgaatccactt
caacaacaacaacagcagcagcaaattcaacagcgtcctatgatgagtggaaatttgcag
cagcaacagcaaatggcagtattacagcagcagcagcaacaaggtgttatgcccagtcaa
ggcacgaacatctctaatatccctccccagttaagggaaatgatgagacggcatttgcag
cagcagcagcaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaa
caacaacaacaacagcagcagcagcatcaacagatgggtaaccatgctcaattccagcat
cctcaaccaccccagcagcagggttatctaggccagtctggaattcctcctcagcagcca
ggccaacctcacccaggtggtctccagcaacaacagggaggggcccagcctggaacccag
caaaactactctgggtctgtgtcccatcagcaggttgcagcagctttgcaacataggtta
cagcaacagcaacttcaaatgcaacagcagcagagtgctatgggaggatatcaaggtgct
gatggaggacctggaggtggtggtcccctccagcagcagcagcagcagatgcagtcagct
cctatgggctcacagccgcaaatgtttcagcaagctatacagcaacggctcctacagcag
caacagtcacacctcggaggaggatctcctgctcaacacaatcctatgagtccacagcag
tcccagcaacagatgtcccagtctccccatttacagggccagttgcccaattctctcggc
aaccaagttcgctctccccaaccatcacctcgtccccagtcccagccaccaaactctagt
ccatctcctcgcttgcagccccagccgtcaccccatcacatctcaccccagactgggtcg
ccccacccaggtcaccttcctcaacaccacagtggcatggctgctcctccaccgccacag
caacaagcacaggcatcccagcagcagcaacaggttaacgccatggaccagggcccattt
ggagcagaccagaatgctatgctttcacagttaagcgggatgggagccttacatgggcag
ggaacaaatgacatgctgacgaataaccaggatatgggctcgaacattaatcactcgttg
gatttgatgtaa

DBGET integrated database retrieval system