KEGG   Danio rerio (zebrafish): 559281Help
Entry
559281            CDS       T01004                                 

Gene name
irs1, si:dkeyp-51h1.1, wu:fb51f11, wu:fd14h02
Definition
insulin receptor substrate 1
Orthology
K16172  
insulin receptor substrate 1
Organism
dre  Danio rerio (zebrafish)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    559281 (irs1)
   04150 mTOR signaling pathway
    559281 (irs1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    559281 (irs1)
   04920 Adipocytokine signaling pathway
    559281 (irs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
15
AA seq 1119 aa AA seqDB search
MASPTTEQGCFSDVKKVGYLRKPKSMHKRFFVLRAASASGPSRLEYYENEKKWRHKSGAP
KRSIPLESCFNINKRADSKNKHLVALYTKDEYFAIAADSEIEQESWYEALVDLHNRGKVH
ETAPGRGVGEDNYGEATPGPAFKEVWQVILKPKGLGHTKNLIGVYRLCLTNKTISFVKLN
SDAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEAMK
AMSEEFRPRSKSQSSSNCSNPISVPVRRHHHNNPPPSQVGLGRRSRAESVTATSPVRPGK
HSHSFRVRASSDGEGTMSRPASVDGSPSSPSNARPQSQRHRGGSRLHPPLNHSRSIPTPT
SRCSPSAISPISLSSSSTSGHGSTSDCLFPRRSSASISGSPSDGGFISSDEYGSSPCDFR
SSFRSVTPDSLGHTPPAREEEINNYICMAKPGSLPGAGSQSRSQSRGTPSRLEEPELEKC
FRKRTHSSGASPPTPCHQKTPSQSPAASLEEYTVMMPTYPRSRSASSSSSTYRHSFMPTH
SYPEEGTDASQAKDERGPDHKDDGYMPMLPGVAPATPTTKSSDYMPMSPKSVSAPQQIIN
PRQHSHVDSNGYMMMSPSGSCSPDGTTNYGKIWTNGINPKLSVESMEGKVSSCGDYINMS
PASCSTTSTPPDCFFNPVEDPPRPMYAYYSLPRSFKHANRKQDQSPLRVSLGSSRLAYAD
SSSSSASSDSLGGQSNSQQSAVKPKRSEGNGRLTRPTRLSLDASKASTLPRTRESPFPPE
PKSPGEYVNIEFNDKAFSASLASLFPPVYSVSDAEAPSDLSSSEYMNMQLGSQARRLCSE
LQTSSSSSDYAIITPSNSVSSPPLPCESICERDYISMQLASCTGFPDTQLMLMTEALPDA
DAPPCSVSPNHDVTTLSGAPGRPALISPLSGLSAFTRVNSTSGRNQGAKVIRADPQGRRR
HSSETFASTATRGSVDTSSTCQSGDVKRHSSASFENVWLRPDQASAASTAPSASTVTNGR
RETASGQIPTLTNHDQNGLNYIDLDLMQNGEQHVPDWNAFQSRPVELGAVEGIEELSAYA
SINFQKSDETRGNLTHREEPLVKVDTGRDMEGWRGSKER
NT seq 3360 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcccgactacggagcaaggatgtttttcagacgtgaaaaaggtgggttattta
aggaaacccaaaagcatgcacaaaaggttttttgtactgagggcggcgagcgcctccgga
ccgtcccgactggagtactatgaaaacgagaagaagtggagacacaagtctggagcgccg
aaaagatccattccgctggagagctgctttaacatcaacaaaagagcggattcaaaaaac
aaacatctcgtcgcgctttataccaaggatgagtactttgctatcgctgctgacagcgag
atcgagcaagagtcatggtatgaagccctggttgatctccataacagaggtaaggtccac
gaaactgccccgggccgtggagttggcgaggataattacggggaagccacgccgggacct
gcctttaaagaggtttggcaagttatattgaaaccaaagggtctgggtcacacaaagaac
ttgattggagtttacagattatgcctcaccaataagactatcagctttgtgaaactgaat
tcggatgcagcagctgtggttttgcagttgatgaacattaggagatgtggtcactctgaa
aatttcttttttattgaagtcggccgatctgctgtgacaggccccggggagttttggatg
caagtggatgactctgttgtggctcagaacatgcatgaaactatattagaagccatgaaa
gccatgagtgaggagttcagaccccgcagcaaaagccagtcatcttctaactgctcaaac
cccatctcagtgcctgtcaggcggcatcatcacaataatcctccccctagtcaagttggc
ttaggcaggcgctctcgggcggagagtgtgacggccacttctcctgttaggcctggcaaa
cacagccattcgtttagagtgagagcatctagtgatggagagggcaccatgtccaggccg
gcatctgtggacgggagtccaagcagcccgagcaatgcccgacctcaatcgcaacggcac
agagggggatccagacttcacccgccactcaatcacagcagatcaatacccacgcccacc
tcacggtgctccccctcagccatcagccccatcagcctgtcctccagcagcacgagcggg
catggctccacatctgactgcctctttccacgtcgctctagtgcctcgatatctggatca
cccagcgatggcggattcatctcctcagatgaatatggatccagcccctgtgactttcga
agctcgtttcgtagcgtgactccagactcgcttggccacacaccacctgccagggaggaa
gagataaacaactacatctgcatggcaaagcccggttcacttcctggtgccgggagccag
tcacgaagccaatctagaggaacaccgtcaagactagaggagcctgagttggaaaaatgt
tttcggaaaagaactcattcttctggtgcttcgccgccaactccatgccatcagaaaact
ccctcacaatcgcctgctgcatctttagaggaatacactgtgatgatgcctacataccca
cgaagccgctctgcatcatcgtcatcatcaacatataggcactcattcatgccaacacat
tcatacccagaggaaggtacagatgcatcacaagcaaaagatgaaagggggccagatcac
aaagatgacggctatatgcccatgctgccaggcgttgcgcctgcaacccctacaaccaaa
agcagtgactacatgcccatgagtccaaaaagtgtgtctgcaccacagcaaattatcaac
cccaggcaacactcgcatgtcgactccaatggttacatgatgatgtcaccaagtggcagc
tgctctccagatggcacaacaaactatggcaagatctggacgaatggcatcaaccctaag
ctctccgtagagagtatggaaggtaaagtgtcgtcatgtggagattacataaacatgtct
ccagctagttgctcaacaacaagtacgcctccagactgctttttcaaccctgtggaagat
cctcccaggcctatgtatgcttactactctttgccccgctcattcaaacatgctaacagg
aagcaggatcagagcccgcttcgagtgtcactgggctcgagtcgattagcatacgctgac
tcctcttcatcttcagcaagcagtgacagcttgggtggtcaaagcaattcccagcagtct
gctgtcaaacccaaaaggtcagagggcaacggtaggctgacacgtccaacacggctgtca
ctggacgccagcaaagcaagtactcttccacgcacacgtgagagccccttccctcctgag
cctaaaagtcctggggagtatgtcaacattgagttcaacgacaaggcattttcagcgagc
ttagcatcgctgttcccacctgtttattcagtaagtgatgctgaggccccgtcggatctt
tcatcatctgagtacatgaacatgcagctgggatcccaggccagacggctgtgctccgaa
ttgcagacttcctcttccagttcagattatgccataatcacaccgtcaaactctgtatcc
tcgcctccactgccatgtgagagcatatgtgaacgtgactacatcagcatgcagttagca
tcctgcactggctttcctgacacacaattgatgctaatgaccgaggccctgccagatgca
gatgcccctccttgttctgtatcacccaatcatgacgtgacgacattaagcggcgctcct
ggaagaccagctctgattagccctttatcaggtctgagtgcattcacacgggttaactcc
acttccggacgaaaccagggcgctaaagtaatacgtgctgacccacagggtcgacggcgg
cacagttcagagacttttgcatccacagcgaccagagggtcagtcgacacatcgagcacc
tgtcaatcaggggatgtaaagcgccacagctccgcctccttcgagaatgtgtggttgaga
cctgatcaggcctctgctgcttctaccgctccatctgcatcgacagtaaccaacggacga
agggaaaccgcttcaggccaaattcccacattaacaaaccatgaccagaacggcctgaac
tacattgatctggatctaatgcagaatggagagcaacatgttcctgattggaatgctttc
cagtctcggccggtggagctgggagctgttgaaggtatagaagagctcagtgcctatgcc
agtataaacttccagaaatcagatgagaccagagggaatctcacacacagagaagagccg
cttgttaaagtagacacaggcagagatatggagggatggagaggaagtaaagagaggtag

DBGET integrated database retrieval system