KEGG   Danio rerio (zebrafish): 559281Help
Entry
559281            CDS       T01004                                 

Gene name
irs1, si:dkeyp-51h1.1, wu:fb51f11, wu:fd14h02
Definition
insulin receptor substrate 1
Orthology
K16172  
insulin receptor substrate 1
Organism
dre  Danio rerio (zebrafish)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dre04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dre04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:dre04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:dre04920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
15
AA seq 1119 aa AA seqDB search
MASPTTEQGCFSDVKKVGYLRKPKSMHKRFFVLRAASASGPSRLEYYENEKKWRHKSGAP
KRSIPLESCFNINKRADSKNKHLVALYTKDEYFAIAADSEIEQESWYEALVDLHNRGKVH
ETAPGRGVGEDNYGEATPGPAFKEVWQVILKPKGLGHTKNLIGVYRLCLTNKTISFVKLN
SDAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEAMK
AMSEEFRPRSKSQSSSNCSNPISVPVRRHHHNNPPPSQVGLGRRSRAESVTATSPVRPGK
HSHSFRVRASSDGEGTMSRPASVDGSPSSPSNARPQSQRHRGGSRLHPPLNHSRSIPTPT
SRCSPSAISPISLSSSSTSGHGSTSDCLFPRRSSASISGSPSDGGFISSDEYGSSPCDFR
SSFRSVTPDSLGHTPPAREEEINNYICMAKPGSLPGAGSQSRSQSRGTPSRLEEPELEKC
FRKRTHSSGASPPTPCHQKTPSQSPAASLEEYTVMMPTYPRSRSASSSSSTYRHSFMPTH
SYPEEGTDASQAKDERGPDHKDDGYMPMLPGVAPATPTTKSSDYMPMSPKSVSAPQQIIN
PRQHSHVDSNGYMMMSPSGSCSPDGTTNYGKIWTNGINPKLSVESMEGKVSSCGDYINMS
PASCSTTSTPPDCFFNPVEDPPRPMYAYYSLPRSFKHANRKQDQSPLRVSLGSSRLAYAD
SSSSSASSDSLGGQSNSQQSAVKPKRSEGNGRLTRPTRLSLDASKASTLPRTRESPFPPE
PKSPGEYVNIEFNDKAFSASLASLFPPVYSVSDAEAPSDLSSSEYMNMQLGSQARRLCSE
LQTSSSSSDYAIITPSNSVSSPPLPCESICERDYISMQLASCTGFPDTQLMLMTEALPDA
DAPPCSVSPNHDVTTLSGAPGRPALISPLSGLSAFTRVNSTSGRNQGAKVIRADPQGRRR
HSSETFASTATRGSVDTSSTCQSGDVKRHSSASFENVWLRPDQASAASTAPSASTVTNGR
RETASGQIPTLTNHDQNGLNYIDLDLMQNGEQHVPDWNAFQSRPVELGAVEGIEELSAYA
SINFQKSDETRGNLTHREEPLVKVDTGRDMEGWRGSKER
NT seq 3360 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcccgactacggagcaaggatgtttttcagacgtgaaaaaggtgggttattta
aggaaacccaaaagcatgcacaaaaggttttttgtactgagggcggcgagcgcctccgga
ccgtcccgactggagtactatgaaaacgagaagaagtggagacacaagtctggagcgccg
aaaagatccattccgctggagagctgctttaacatcaacaaaagagcggattcaaaaaac
aaacatctcgtcgcgctttataccaaggatgagtactttgctatcgctgctgacagcgag
atcgagcaagagtcatggtatgaagccctggttgatctccataacagaggtaaggtccac
gaaactgccccgggccgtggagttggcgaggataattacggggaagccacgccgggacct
gcctttaaagaggtttggcaagttatattgaaaccaaagggtctgggtcacacaaagaac
ttgattggagtttacagattatgcctcaccaataagactatcagctttgtgaaactgaat
tcggatgcagcagctgtggttttgcagttgatgaacattaggagatgtggtcactctgaa
aatttcttttttattgaagtcggccgatctgctgtgacaggccccggggagttttggatg
caagtggatgactctgttgtggctcagaacatgcatgaaactatattagaagccatgaaa
gccatgagtgaggagttcagaccccgcagcaaaagccagtcatcttctaactgctcaaac
cccatctcagtgcctgtcaggcggcatcatcacaataatcctccccctagtcaagttggc
ttaggcaggcgctctcgggcggagagtgtgacggccacttctcctgttaggcctggcaaa
cacagccattcgtttagagtgagagcatctagtgatggagagggcaccatgtccaggccg
gcatctgtggacgggagtccaagcagcccgagcaatgcccgacctcaatcgcaacggcac
agagggggatccagacttcacccgccactcaatcacagcagatcaatacccacgcccacc
tcacggtgctccccctcagccatcagccccatcagcctgtcctccagcagcacgagcggg
catggctccacatctgactgcctctttccacgtcgctctagtgcctcgatatctggatca
cccagcgatggcggattcatctcctcagatgaatatggatccagcccctgtgactttcga
agctcgtttcgtagcgtgactccagactcgcttggccacacaccacctgccagggaggaa
gagataaacaactacatctgcatggcaaagcccggttcacttcctggtgccgggagccag
tcacgaagccaatctagaggaacaccgtcaagactagaggagcctgagttggaaaaatgt
tttcggaaaagaactcattcttctggtgcttcgccgccaactccatgccatcagaaaact
ccctcacaatcgcctgctgcatctttagaggaatacactgtgatgatgcctacataccca
cgaagccgctctgcatcatcgtcatcatcaacatataggcactcattcatgccaacacat
tcatacccagaggaaggtacagatgcatcacaagcaaaagatgaaagggggccagatcac
aaagatgacggctatatgcccatgctgccaggcgttgcgcctgcaacccctacaaccaaa
agcagtgactacatgcccatgagtccaaaaagtgtgtctgcaccacagcaaattatcaac
cccaggcaacactcgcatgtcgactccaatggttacatgatgatgtcaccaagtggcagc
tgctctccagatggcacaacaaactatggcaagatctggacgaatggcatcaaccctaag
ctctccgtagagagtatggaaggtaaagtgtcgtcatgtggagattacataaacatgtct
ccagctagttgctcaacaacaagtacgcctccagactgctttttcaaccctgtggaagat
cctcccaggcctatgtatgcttactactctttgccccgctcattcaaacatgctaacagg
aagcaggatcagagcccgcttcgagtgtcactgggctcgagtcgattagcatacgctgac
tcctcttcatcttcagcaagcagtgacagcttgggtggtcaaagcaattcccagcagtct
gctgtcaaacccaaaaggtcagagggcaacggtaggctgacacgtccaacacggctgtca
ctggacgccagcaaagcaagtactcttccacgcacacgtgagagccccttccctcctgag
cctaaaagtcctggggagtatgtcaacattgagttcaacgacaaggcattttcagcgagc
ttagcatcgctgttcccacctgtttattcagtaagtgatgctgaggccccgtcggatctt
tcatcatctgagtacatgaacatgcagctgggatcccaggccagacggctgtgctccgaa
ttgcagacttcctcttccagttcagattatgccataatcacaccgtcaaactctgtatcc
tcgcctccactgccatgtgagagcatatgtgaacgtgactacatcagcatgcagttagca
tcctgcactggctttcctgacacacaattgatgctaatgaccgaggccctgccagatgca
gatgcccctccttgttctgtatcacccaatcatgacgtgacgacattaagcggcgctcct
ggaagaccagctctgattagccctttatcaggtctgagtgcattcacacgggttaactcc
acttccggacgaaaccagggcgctaaagtaatacgtgctgacccacagggtcgacggcgg
cacagttcagagacttttgcatccacagcgaccagagggtcagtcgacacatcgagcacc
tgtcaatcaggggatgtaaagcgccacagctccgcctccttcgagaatgtgtggttgaga
cctgatcaggcctctgctgcttctaccgctccatctgcatcgacagtaaccaacggacga
agggaaaccgcttcaggccaaattcccacattaacaaaccatgaccagaacggcctgaac
tacattgatctggatctaatgcagaatggagagcaacatgttcctgattggaatgctttc
cagtctcggccggtggagctgggagctgttgaaggtatagaagagctcagtgcctatgcc
agtataaacttccagaaatcagatgagaccagagggaatctcacacacagagaagagccg
cttgttaaagtagacacaggcagagatatggagggatggagaggaagtaaagagaggtag

DBGET integrated database retrieval system