KEGG   Danio rerio (zebrafish): 559403Help
Entry
559403            CDS       T01004                                 

Gene name
acaca, acc, fj43d01, im:7138837, si:ch211-199d18.1, wu:fj43d01
Definition
acetyl-CoA carboxylase alpha
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
dre  Danio rerio (zebrafish)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    559403 (acaca)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    559403 (acaca)
   00640 Propanoate metabolism
    559403 (acaca)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    559403 (acaca)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    559403 (acaca)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    559403 (acaca)
Enzymes [BR:dre01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     559403 (acaca)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     559403 (acaca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
5
AA seq 2390 aa AA seqDB search
MAEQDSTEKKLPAVAALHSHFIVGSVSEENSEDETAGKLDLQLEDNPRSLSPSSVSSDST
YEMGFDSLDGPLHNMRPSMSGLHLVKQGRDRRRIDLQRDFTVASPAEFVTRFGGNKVIEK
VLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPG
GTNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLHKNGIAFMGPPSQAMWAL
GDKIASSIVAQTAGIPTLPWSGTGLTVEWTENDQKKGIINVPTELYEQGCVHDVEAGLKA
AEQVGFPVMVKASEGGGGKGIRKVNCAEDFPNLYRQVQAEVPGSPIFVMQLAKHARHLEV
QILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATSDVFEDMEKCAVKLAKMVGYVSA
GTVEYLYSQDSSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLHRIKDIRVLY
GMQPWGDSPIDFDGLSTTPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGY
FSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLET
ESFQHNSIDTGWLDRLISEKMQAERPDTMLGVVSGALHVADVNFRNSVSNFLHSLERGQV
LPAHTLLNTVDVELIYEGTKYVLKVTRQSPNSYVVIMNCSSVEVDVHRLSDGGMLLSYDG
SSYTTYMKEEVDRYRIIIGNKTCVFEKENDPSVLRSPSAGKLIQYTVEDGGHVFAGQCYA
EIEVMKMVMTLTASESGCIHYVKRAGAVLEPGCIIGKLQLDDPSRVQQAELYTGTLPSIQ
SVALRGEKLHRVFHSTLGHLVHIMNGYCLPEPFFSAKLKEWVERLMKTLRDPSLPLLELQ
DIMTSVSGRIPPAVEKAIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREV
FFMNTQSIVQLVQKYRSGIRGHMKAVVMDLLRQYLRVEVQFQHGHYDKCVFALREENKVD
MANVLNYIFSHAQVTKKNCLVTMLIDQLCGRDPTLTDELMAILTELTQLSKTTNAKVALR
ARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYH
SNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCIVEFQFMLPTSHPNRGNIPTLNRK
LSAPLQDYKPPANTANTSGATEAASDSAESEDRMSFSSNLNHYGMVHVASVSDVLLDTSF
TPPCQRMGAMVSFRSFQEFTRNIKDVLSCFSDSPPSTPTFPEGGNPVLYREEDSKSIQDE
PIHILNVAIKTDSDIDDDGLAAMFREFTQSKKSLLFDHGIRRLTFLVAQKDFRKQINCEV
DQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFALTAIPCANHKMHLY
LGAARVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLHNEAERLLLEAMDELEVAFNNT
TVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGK
QIPIRLFLTNESGYYLDISLYKEVTDSRTGQVGHKDRQIMFQAYGDKQGPLHGMLINTPY
VTKDLLQSKRFQAQSLGTTYVYDFPEMFRQALRKLWQSMDAHANLPKCPLPSELLTFTEL
VLDSQGQLVQMNRLPGGNEIGMVAWRMTLRTPEYPAGREIIVISNDITHKIGSFGPQEDV
LFQQASEMARESGIPRIYIAANSGARIGLAEEIRHMFHVAWQDPVDPYKGFKYLYLTPQD
YKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEDIITM
NLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHN
NGVTHTNVCDDFEGVYTLLHWLSYMPKNMSSPVPILSAKDPIDRAIEFVPTKAPYDPRWM
LAGRPNQNIKGAWVSGFFDQGSFLEIMQPWAQSVVVGRARLGGIPTGVVAVETRSVELSI
PADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDFNREGLPLIVFANWRGFSGGMKDMY
DQVLKFGAYIVDGLREYRQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKDSRGGV
LEPEGTVEIKFRKKDLVKTMRRVDPVYMGLAERLGTPELSVSERKELESKLKEREEFLLP
IYHQVAVQFADLHDTPGRMQEKGVITDILEWSTSRQFFYWRLRRLLLEETVKRKIQCANS
ELTDGQVQAMLRRWFVEAEGAVKAYLWDSNEDVVEWLERQLAEEEGARSVIDENIKYIRR
DHILKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDTPASS
NT seq 7173 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcaagactccaccgagaagaaacttccagctgtggctgcgctgcactctcac
ttcatcgtgggctctgtgtctgaggaaaactctgaggatgagaccgcagggaagctggac
ctgcagctggaggacaatccacgctccctttccccctcctccgtcagttcagatagcact
tatgagatgggcttcgacagcctggacggacccttgcacaatatgaggcctagcatgtca
ggacttcaccttgtgaagcagggtagggaccgcagacgtatcgacctgcagagggatttt
actgttgcttctccagctgagtttgtcacccgcttcggtggaaacaaagttattgagaag
gtccttattgcgaacaatggcattgctgcagtcaagtgcatgcgctctatccgacgctgg
gcttacgaaatgtttcggaatgaacgggccatacgctttgttgtcatggtgaccccagag
gaccttaaagctaatgcagagtacatcaagatggcagatcactatgtgcctgtgccagga
gggacaaacaacaacaactacgctaatgtggaactcatcttggacattgctaaacgaatt
cctgttcaagctgtgtgggctggctggggtcatgcctctgaaaatcccaaacttcctgaa
ttgctgcacaagaacggcatcgccttcatgggtcctccaagtcaggctatgtgggctctc
ggggataagatcgcttcctctattgtggcccagacagcaggcattcccacactaccctgg
agtggaacaggactgactgtagagtggacagagaatgaccagaagaaagggattattaat
gttcctactgagctatacgagcaaggctgtgtgcacgacgtggaggctggattgaaggct
gctgaacaagtgggcttccctgtgatggtgaaggcatctgagggcggaggaggaaaaggg
atccggaaagtcaactgtgcagaagacttccccaacctctatagacaggttcaagctgag
gttccaggttccccgatttttgtcatgcaattggccaaacatgctcgtcatctggaggtt
cagatcttggctgatcagtacggtaatgccatctctctgttcggccgtgattgctccgtg
cagcgcagacaccagaagatcattgaagaagccccggctactatcgctacatcagacgtg
tttgaagatatggagaagtgtgctgtgaagttggcgaagatggtgggctatgtgagtgcg
ggtacagtggagtatctgtacagtcaggacagcagcttttacttcctggagctcaatcca
cgtcttcaagtggaacatccttgtactgagatggtggctgacgttaacctgccagcagct
caactgcagatcgctatgggcatcccacttcaccgtattaaagacatcagagtgctgtat
gggatgcagccatggggagattcccccattgactttgatggactctctaccaccccctgt
ccacgaggacacgtcatcgcagctcgaattaccagtgagaacccagatgagggttttaaa
cccagctctggaactgtccaggaattaaatttccgcagtaacaagaatgtgtggggctac
ttcagcgtggcggcagctggaggactgcatgagtttgcagactctcagtttggccactgc
ttctcctggggagagaaccgtgaggaagccatctcaaacatggtggtggccctcaaggag
ctgtccatcagaggagacttcaggactacagtggagtatctcataaagctgcttgaaacg
gagagtttccagcacaacagcattgacacaggatggctggacaggctcatctctgagaag
atgcaggcagagcgtcctgatactatgctgggggtagtaagtggagctctgcatgtggct
gatgttaacttcaggaacagtgtgtccaacttcctgcactcactggagagagggcaggtt
ttaccagcacacacgctgctgaacacggtggatgtggagcttatctacgaaggcaccaag
tatgtgctgaaggtgaccaggcagtctcctaactcttatgtggtcatcatgaattgctct
tcggtagaggtggatgttcatcgcttgagtgacggtggtatgttgctctcgtatgatggc
agcagctacaccacctacatgaaggaggaggtagacaggtatcgcatcattatcgggaat
aagacgtgtgtgtttgaaaaggagaacgacccttcagtccttcgctctccttctgctggg
aaactcatccagtatacagtggaggatggaggacatgtgtttgctggacaatgttatgca
gagatagaggtgatgaagatggtgatgactctgacggcctcagagtctggctgtattcac
tatgtgaagagagcaggtgcagtgctggagccaggttgcatcattggcaaactgcagcta
gatgaccccagcagagtacagcaggcggagttgtatacaggaactttacccagcattcag
tctgtggctctcaggggagagaagcttcacagagtcttccacagcactctgggtcactta
gtgcacattatgaacggctactgtctgccagagcctttcttcagtgccaagctgaaagaa
tgggtggagcgtcttatgaagactctaagggacccctccctacccctgctggagcttcag
gacatcatgaccagtgtttcaggccgaatccctcctgcggtggagaaggccatcaaaaaa
gaaatggctcagtatgccagcaacatcacctctgtcctctgccagtttcccagccagcag
attgccaatatactggacagtcatgctgccacgctgaacaggaagtcagagagagaggtc
ttcttcatgaacacacagagcatcgtacagctggttcagaagtaccgcagtggcatcaga
ggacatatgaaagcagtggtgatggatctcctcaggcagtatttgagagtggaggttcag
tttcagcatggtcactatgacaagtgtgtatttgcactacgagaggaaaacaaagtagac
atggccaatgtgctcaactacatattctctcatgctcaagtcacaaagaagaactgtctg
gtcaccatgctgattgatcagctatgtgggcgagacccgaccctgacggacgagctgatg
gccatactcacagagctcacacagctcagcaagaccaccaatgccaaggtggcattgcgg
gcacggcaggttctcatcgcttctcaccttccctcatatgagctgcgacacaatcaggtg
gaatccattttcctgtctgccatcgacatgtatggacaccagttctgcattgagaacctg
cagaaactgatcctgtcagaaacatccatctttgatgtgctgccaaatttcttttaccat
agtaatcaggtggtacggatggctgctctcgaggtgtatgttcgtagagcttacatcgct
tatgaactcaacagcgtccagcaccgtcagctgaaggacaacacctgcatcgtggagttc
cagttcatgctgcccacatcccaccccaacagagggaacatccccactctaaacaggaaa
ctgtctgccccactgcaggactacaaacctccagctaacacagctaacactagtggagcc
acagaggcagctagtgactctgctgagagtgaggacagaatgtccttttcctcaaacctg
aaccactacggcatggtccacgtggccagcgttagtgatgtgctcctagacacctccttt
accccaccctgtcagcgcatgggagccatggtttccttccgctctttccaggagttcacc
aggaacataaaggatgttctgagctgtttctcagactctcctccatcaactccaaccttt
cctgaaggggggaaccctgtgctgtatagagaggaggacagcaagagcattcaagatgag
cccattcatattcttaatgtggcaataaagacggacagtgatattgatgatgatgggctg
gcggccatgtttcgtgagtttacacagtctaagaaatctctgctgtttgaccacggcatc
cgaagacttaccttcctggttgctcagaaggatttcagaaagcaaatcaactgtgaggtg
gaccagaggttccatagagaattccccaaattttttacattccgggctcgagacaagttt
gaggaagaccgtatctacagacacttggaacctgcattagctttccagctggagctcaac
cgcatgcgtaattttgcactgacagccatcccctgtgccaatcataagatgcacctgtac
ttgggagctgcccgtgtggaagtaggcactgaggtcacagattaccgcttctttgtgcgg
gcaatcatccgtcactcagatttggtcaccaaggaagcatcatttgagtacctgcacaac
gaggcagaacgcttgctgctggaggccatggatgaactggaagtggctttcaacaacacc
actgtgcgaaccgactgcaatcacatcttcctcaacttcgttccaacagtcatcatggac
ccttcaaagattgaggaatctgtgcgctccatggtcatgcgctacggcagtcgcttgtgg
aagctccgtgtgcttcaagccgagctgaagatcaacatccgattgactcccaccggcaaa
cagatccccatccgcctcttcctgaccaacgagagtggctactacctggacatcagcctg
tacaaggaagtcactgactcccgtacaggacaggtggggcacaaagaccgacagatcatg
ttccaggcatatggagataagcagggtcctcttcatggcatgctcatcaacacaccctac
gtcacaaaagacctgctgcagtccaaacgcttccaggcacagagcctcggcactacctat
gtttacgacttcccagaaatgtttcgccaggctttaaggaagctgtggcaatccatggat
gcacacgccaacttgcccaagtgccctcttccatcagaactgctcaccttcacagagctg
gttctggattctcagggtcagctggtgcagatgaaccgcctacctggagggaatgagatt
ggcatggtagcatggcgaatgaccctccggacccctgagtatccagccggccgtgagatt
atagtgatcagcaatgacatcacacataagattggctcgtttgggccacaagaagatgtt
ctgttccagcaagcttcagaaatggcaagagaaagtggcattccacggatctatattgct
gccaacagcggagctcgtataggcctggcagaggagatcagacacatgtttcatgtggcc
tggcaggatccggtggacccatacaagggttttaagtacctatacctcacaccacaggac
tataagaaggtgtctgctctgaactcagtccactgtgaacatgtggaggatgagggggaa
tccaggtataaaatcactgatatcattgggaaagaggaagggttgggtgtggagaacttg
agaggttctggcatgatcgcaggtgaatcgtcactggcgtatgaggatattatcaccatg
aatctggtgacatgcagggccattggaatcggagcgtacttggtgagactgggccaaaga
accatacaggtggaaaactctcatatcatcctgactggagccggagctctcaataaggtt
ctcgggcgtgaggtgtacacttccaataaccaactgggtggagtacagatcatgcacaat
aacggagtcacacacaccaatgtgtgcgatgattttgagggagtgtatacattgctgcac
tggctgtcttacatgccaaagaatatgtccagccctgtgccgatactctctgctaaagat
cccattgatcgagcgatagagtttgtcccaaccaaggcaccttatgacccacgctggatg
ctagctggacgtcccaatcagaacattaagggtgcatgggtgagtgggttcttcgaccag
ggctcttttctggagatcatgcagccatgggcacagagtgttgtcgtaggacgggccagg
ttgggtgggatcccaactggagtagttgccgtggaaacccgatcagtggagctttcaatc
ccagcagacccagctaatctggactcggaagccaagataatccagcaggctgggcaagtg
tggttccctgattctgctttcaaaactgcacaagccattaaagacttcaatagagaggga
cttccgcttatagtgtttgccaactggagaggtttttctggaggcatgaaagacatgtat
gaccaggtgctgaagtttggagcgtatatagtggacggtctgagagagtacagacagccg
gttctggtgtatatcccaccacaggcggagctccggggaggatcatgggttgtcatagac
cctactatcaatcctcgccacatggaaatgtatgcagacaaagacagccgtggcggtgtg
ctggagcctgaaggcacagtggagatcaagttccgcaaaaaagacctggtgaagaccatg
cgacgggtggaccctgtgtacatggggcttgcagaaagactgggaaccccagagttgagt
gtgtctgagcgtaaagagctggagagtaaactaaaagagagagaagagttcctgctgccc
atatatcatcaagtagctgttcagttcgctgaccttcatgacacaccgggccgcatgcag
gagaaaggagtcatcactgatatccttgagtggagcacgtctcggcagtttttctactgg
cgtttgcggaggttattgctggaggaaacggtgaagaggaagatccagtgtgctaacagt
gagctgacggacggacaggttcaggctatgcttcgccgttggttcgtggaagcagaggga
gctgtgaaagcgtatttgtgggacagtaatgaagatgtggtggagtggttggagaggcag
ctggcagaggaagaaggcgccagatccgtcatcgacgagaatatcaaatatattcgcaga
gatcacatcctcaaacagatccgcagcctggttcaagctaaccctgaggtggctatggac
tccattgtacacatgacccagcacatttcccccacacagcgcgccgaagtcgtccgcatc
ctctccaccatggacaccccagcctcctcgtag

DBGET integrated database retrieval system