KEGG   Danio rerio (zebrafish): 559403Help
Entry
559403            CDS       T01004                                 

Gene name
acaca, acc, fj43d01, im:7138837, si:ch211-199d18.1, wu:fj43d01
Definition
acetyl-Coenzyme A carboxylase alpha
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
dre  Danio rerio (zebrafish)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dre01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dre00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dre00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:dre00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:dre04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
5
AA seq 2390 aa AA seqDB search
MAEQDSTEKKLPAVAALHSHFIVGSVSEENSEDETAGKLDLQLEDNPRSLSPSSVSSDST
YEMGFDSLDGPLHNMRPSMSGLHLVKQGRDRRRIDLQRDFTVASPAEFVTRFGGNKVIEK
VLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPG
GTNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLHKNGIAFMGPPSQAMWAL
GDKIASSIVAQTAGIPTLPWSGTGLTVEWTENDQKKGIINVPTELYEQGCVHDVEAGLKA
AEQVGFPVMVKASEGGGGKGIRKVNCAEDFPNLYRQVQAEVPGSPIFVMQLAKHARHLEV
QILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATSDVFEDMEKCAVKLAKMVGYVSA
GTVEYLYSQDSSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLHRIKDIRVLY
GMQPWGDSPIDFDGLSTTPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGY
FSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLET
ESFQHNSIDTGWLDRLISEKMQAERPDTMLGVVSGALHVADVNFRNSVSNFLHSLERGQV
LPAHTLLNTVDVELIYEGTKYVLKVTRQSPNSYVVIMNCSSVEVDVHRLSDGGMLLSYDG
SSYTTYMKEEVDRYRIIIGNKTCVFEKENDPSVLRSPSAGKLIQYTVEDGGHVFAGQCYA
EIEVMKMVMTLTASESGCIHYVKRAGAVLEPGCIIGKLQLDDPSRVQQAELYTGTLPSIQ
SVALRGEKLHRVFHSTLGHLVHIMNGYCLPEPFFSAKLKEWVERLMKTLRDPSLPLLELQ
DIMTSVSGRIPPAVEKAIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREV
FFMNTQSIVQLVQKYRSGIRGHMKAVVMDLLRQYLRVEVQFQHGHYDKCVFALREENKVD
MANVLNYIFSHAQVTKKNCLVTMLIDQLCGRDPTLTDELMAILTELTQLSKTTNAKVALR
ARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYH
SNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCIVEFQFMLPTSHPNRGNIPTLNRK
LSAPLQDYKPPANTANTSGATEAASDSAESEDRMSFSSNLNHYGMVHVASVSDVLLDTSF
TPPCQRMGAMVSFRSFQEFTRNIKDVLSCFSDSPPSTPTFPEGGNPVLYREEDSKSIQDE
PIHILNVAIKTDSDIDDDGLAAMFREFTQSKKSLLFDHGIRRLTFLVAQKDFRKQINCEV
DQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFALTAIPCANHKMHLY
LGAARVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLHNEAERLLLEAMDELEVAFNNT
TVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGK
QIPIRLFLTNESGYYLDISLYKEVTDSRTGQVGHKDRQIMFQAYGDKQGPLHGMLINTPY
VTKDLLQSKRFQAQSLGTTYVYDFPEMFRQALRKLWQSMDAHANLPKCPLPSELLTFTEL
VLDSQGQLVQMNRLPGGNEIGMVAWRMTLRTPEYPAGREIIVISNDITHKIGSFGPQEDV
LFQQASEMARESGIPRIYIAANSGARIGLAEEIRHMFHVAWQDPVDPYKGFKYLYLTPQD
YKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEDIITM
NLVTCRAIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHN
NGVTHTNVCDDFEGVYTLLHWLSYMPKNMSSPVPILSAKDPIDRAIEFVPTKAPYDPRWM
LAGRPNQNIKGAWVSGFFDQGSFLEIMQPWAQSVVVGRARLGGIPTGVVAVETRSVELSI
PADPANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDFNREGLPLIVFANWRGFSGGMKDMY
DQVLKFGAYIVDGLREYRQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKDSRGGV
LEPEGTVEIKFRKKDLVKTMRRVDPVYMGLAERLGTPELSVSERKELESKLKEREEFLLP
IYHQVAVQFADLHDTPGRMQEKGVITDILEWSTSRQFFYWRLRRLLLEETVKRKIQCANS
ELTDGQVQAMLRRWFVEAEGAVKAYLWDSNEDVVEWLERQLAEEEGARSVIDENIKYIRR
DHILKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDTPASS
NT seq 7173 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcaagactccaccgagaagaaacttccagctgtggctgcgctgcactctcac
ttcatcgtgggctctgtgtctgaggaaaactctgaggatgagaccgcagggaagctggac
ctgcagctggaggacaatccacgctccctttccccctcctccgtcagttcagatagcact
tatgagatgggcttcgacagcctggacggacccttgcacaatatgaggcctagcatgtca
ggacttcaccttgtgaagcagggtagggaccgcagacgtatcgacctgcagagggatttt
actgttgcttctccagctgagtttgtcacccgcttcggtggaaacaaagttattgagaag
gtccttattgcgaacaatggcattgctgcagtcaagtgcatgcgctctatccgacgctgg
gcttacgaaatgtttcggaatgaacgggccatacgctttgttgtcatggtgaccccagag
gaccttaaagctaatgcagagtacatcaagatggcagatcactatgtgcctgtgccagga
gggacaaacaacaacaactacgctaatgtggaactcatcttggacattgctaaacgaatt
cctgttcaagctgtgtgggctggctggggtcatgcctctgaaaatcccaaacttcctgaa
ttgctgcacaagaacggcatcgccttcatgggtcctccaagtcaggctatgtgggctctc
ggggataagatcgcttcctctattgtggcccagacagcaggcattcccacactaccctgg
agtggaacaggactgactgtagagtggacagagaatgaccagaagaaagggattattaat
gttcctactgagctatacgagcaaggctgtgtgcacgacgtggaggctggattgaaggct
gctgaacaagtgggcttccctgtgatggtgaaggcatctgagggcggaggaggaaaaggg
atccggaaagtcaactgtgcagaagacttccccaacctctatagacaggttcaagctgag
gttccaggttccccgatttttgtcatgcaattggccaaacatgctcgtcatctggaggtt
cagatcttggctgatcagtacggtaatgccatctctctgttcggccgtgattgctccgtg
cagcgcagacaccagaagatcattgaagaagccccggctactatcgctacatcagacgtg
tttgaagatatggagaagtgtgctgtgaagttggcgaagatggtgggctatgtgagtgcg
ggtacagtggagtatctgtacagtcaggacagcagcttttacttcctggagctcaatcca
cgtcttcaagtggaacatccttgtactgagatggtggctgacgttaacctgccagcagct
caactgcagatcgctatgggcatcccacttcaccgtattaaagacatcagagtgctgtat
gggatgcagccatggggagattcccccattgactttgatggactctctaccaccccctgt
ccacgaggacacgtcatcgcagctcgaattaccagtgagaacccagatgagggttttaaa
cccagctctggaactgtccaggaattaaatttccgcagtaacaagaatgtgtggggctac
ttcagcgtggcggcagctggaggactgcatgagtttgcagactctcagtttggccactgc
ttctcctggggagagaaccgtgaggaagccatctcaaacatggtggtggccctcaaggag
ctgtccatcagaggagacttcaggactacagtggagtatctcataaagctgcttgaaacg
gagagtttccagcacaacagcattgacacaggatggctggacaggctcatctctgagaag
atgcaggcagagcgtcctgatactatgctgggggtagtaagtggagctctgcatgtggct
gatgttaacttcaggaacagtgtgtccaacttcctgcactcactggagagagggcaggtt
ttaccagcacacacgctgctgaacacggtggatgtggagcttatctacgaaggcaccaag
tatgtgctgaaggtgaccaggcagtctcctaactcttatgtggtcatcatgaattgctct
tcggtagaggtggatgttcatcgcttgagtgacggtggtatgttgctctcgtatgatggc
agcagctacaccacctacatgaaggaggaggtagacaggtatcgcatcattatcgggaat
aagacgtgtgtgtttgaaaaggagaacgacccttcagtccttcgctctccttctgctggg
aaactcatccagtatacagtggaggatggaggacatgtgtttgctggacaatgttatgca
gagatagaggtgatgaagatggtgatgactctgacggcctcagagtctggctgtattcac
tatgtgaagagagcaggtgcagtgctggagccaggttgcatcattggcaaactgcagcta
gatgaccccagcagagtacagcaggcggagttgtatacaggaactttacccagcattcag
tctgtggctctcaggggagagaagcttcacagagtcttccacagcactctgggtcactta
gtgcacattatgaacggctactgtctgccagagcctttcttcagtgccaagctgaaagaa
tgggtggagcgtcttatgaagactctaagggacccctccctacccctgctggagcttcag
gacatcatgaccagtgtttcaggccgaatccctcctgcggtggagaaggccatcaaaaaa
gaaatggctcagtatgccagcaacatcacctctgtcctctgccagtttcccagccagcag
attgccaatatactggacagtcatgctgccacgctgaacaggaagtcagagagagaggtc
ttcttcatgaacacacagagcatcgtacagctggttcagaagtaccgcagtggcatcaga
ggacatatgaaagcagtggtgatggatctcctcaggcagtatttgagagtggaggttcag
tttcagcatggtcactatgacaagtgtgtatttgcactacgagaggaaaacaaagtagac
atggccaatgtgctcaactacatattctctcatgctcaagtcacaaagaagaactgtctg
gtcaccatgctgattgatcagctatgtgggcgagacccgaccctgacggacgagctgatg
gccatactcacagagctcacacagctcagcaagaccaccaatgccaaggtggcattgcgg
gcacggcaggttctcatcgcttctcaccttccctcatatgagctgcgacacaatcaggtg
gaatccattttcctgtctgccatcgacatgtatggacaccagttctgcattgagaacctg
cagaaactgatcctgtcagaaacatccatctttgatgtgctgccaaatttcttttaccat
agtaatcaggtggtacggatggctgctctcgaggtgtatgttcgtagagcttacatcgct
tatgaactcaacagcgtccagcaccgtcagctgaaggacaacacctgcatcgtggagttc
cagttcatgctgcccacatcccaccccaacagagggaacatccccactctaaacaggaaa
ctgtctgccccactgcaggactacaaacctccagctaacacagctaacactagtggagcc
acagaggcagctagtgactctgctgagagtgaggacagaatgtccttttcctcaaacctg
aaccactacggcatggtccacgtggccagcgttagtgatgtgctcctagacacctccttt
accccaccctgtcagcgcatgggagccatggtttccttccgctctttccaggagttcacc
aggaacataaaggatgttctgagctgtttctcagactctcctccatcaactccaaccttt
cctgaaggggggaaccctgtgctgtatagagaggaggacagcaagagcattcaagatgag
cccattcatattcttaatgtggcaataaagacggacagtgatattgatgatgatgggctg
gcggccatgtttcgtgagtttacacagtctaagaaatctctgctgtttgaccacggcatc
cgaagacttaccttcctggttgctcagaaggatttcagaaagcaaatcaactgtgaggtg
gaccagaggttccatagagaattccccaaattttttacattccgggctcgagacaagttt
gaggaagaccgtatctacagacacttggaacctgcattagctttccagctggagctcaac
cgcatgcgtaattttgcactgacagccatcccctgtgccaatcataagatgcacctgtac
ttgggagctgcccgtgtggaagtaggcactgaggtcacagattaccgcttctttgtgcgg
gcaatcatccgtcactcagatttggtcaccaaggaagcatcatttgagtacctgcacaac
gaggcagaacgcttgctgctggaggccatggatgaactggaagtggctttcaacaacacc
actgtgcgaaccgactgcaatcacatcttcctcaacttcgttccaacagtcatcatggac
ccttcaaagattgaggaatctgtgcgctccatggtcatgcgctacggcagtcgcttgtgg
aagctccgtgtgcttcaagccgagctgaagatcaacatccgattgactcccaccggcaaa
cagatccccatccgcctcttcctgaccaacgagagtggctactacctggacatcagcctg
tacaaggaagtcactgactcccgtacaggacaggtggggcacaaagaccgacagatcatg
ttccaggcatatggagataagcagggtcctcttcatggcatgctcatcaacacaccctac
gtcacaaaagacctgctgcagtccaaacgcttccaggcacagagcctcggcactacctat
gtttacgacttcccagaaatgtttcgccaggctttaaggaagctgtggcaatccatggat
gcacacgccaacttgcccaagtgccctcttccatcagaactgctcaccttcacagagctg
gttctggattctcagggtcagctggtgcagatgaaccgcctacctggagggaatgagatt
ggcatggtagcatggcgaatgaccctccggacccctgagtatccagccggccgtgagatt
atagtgatcagcaatgacatcacacataagattggctcgtttgggccacaagaagatgtt
ctgttccagcaagcttcagaaatggcaagagaaagtggcattccacggatctatattgct
gccaacagcggagctcgtataggcctggcagaggagatcagacacatgtttcatgtggcc
tggcaggatccggtggacccatacaagggttttaagtacctatacctcacaccacaggac
tataagaaggtgtctgctctgaactcagtccactgtgaacatgtggaggatgagggggaa
tccaggtataaaatcactgatatcattgggaaagaggaagggttgggtgtggagaacttg
agaggttctggcatgatcgcaggtgaatcgtcactggcgtatgaggatattatcaccatg
aatctggtgacatgcagggccattggaatcggagcgtacttggtgagactgggccaaaga
accatacaggtggaaaactctcatatcatcctgactggagccggagctctcaataaggtt
ctcgggcgtgaggtgtacacttccaataaccaactgggtggagtacagatcatgcacaat
aacggagtcacacacaccaatgtgtgcgatgattttgagggagtgtatacattgctgcac
tggctgtcttacatgccaaagaatatgtccagccctgtgccgatactctctgctaaagat
cccattgatcgagcgatagagtttgtcccaaccaaggcaccttatgacccacgctggatg
ctagctggacgtcccaatcagaacattaagggtgcatgggtgagtgggttcttcgaccag
ggctcttttctggagatcatgcagccatgggcacagagtgttgtcgtaggacgggccagg
ttgggtgggatcccaactggagtagttgccgtggaaacccgatcagtggagctttcaatc
ccagcagacccagctaatctggactcggaagccaagataatccagcaggctgggcaagtg
tggttccctgattctgctttcaaaactgcacaagccattaaagacttcaatagagaggga
cttccgcttatagtgtttgccaactggagaggtttttctggaggcatgaaagacatgtat
gaccaggtgctgaagtttggagcgtatatagtggacggtctgagagagtacagacagccg
gttctggtgtatatcccaccacaggcggagctccggggaggatcatgggttgtcatagac
cctactatcaatcctcgccacatggaaatgtatgcagacaaagacagccgtggcggtgtg
ctggagcctgaaggcacagtggagatcaagttccgcaaaaaagacctggtgaagaccatg
cgacgggtggaccctgtgtacatggggcttgcagaaagactgggaaccccagagttgagt
gtgtctgagcgtaaagagctggagagtaaactaaaagagagagaagagttcctgctgccc
atatatcatcaagtagctgttcagttcgctgaccttcatgacacaccgggccgcatgcag
gagaaaggagtcatcactgatatccttgagtggagcacgtctcggcagtttttctactgg
cgtttgcggaggttattgctggaggaaacggtgaagaggaagatccagtgtgctaacagt
gagctgacggacggacaggttcaggctatgcttcgccgttggttcgtggaagcagaggga
gctgtgaaagcgtatttgtgggacagtaatgaagatgtggtggagtggttggagaggcag
ctggcagaggaagaaggcgccagatccgtcatcgacgagaatatcaaatatattcgcaga
gatcacatcctcaaacagatccgcagcctggttcaagctaaccctgaggtggctatggac
tccattgtacacatgacccagcacatttcccccacacagcgcgccgaagtcgtccgcatc
ctctccaccatggacaccccagcctcctcgtag

DBGET integrated database retrieval system