KEGG   Danio rerio (zebrafish): 559524Help
Entry
559524            CDS       T01004                                 

Gene name
ptpn5
Definition
protein tyrosine phosphatase, non-receptor type 5
Orthology
K18018  
tyrosine-protein phosphatase non-receptor type 5 [EC:3.1.3.48]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    559524 (ptpn5)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     559524 (ptpn5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
7
AA seq 529 aa AA seqDB search
MQDVFESSMAEAPVGEDAPKEQDGATSHAHDPLPGIGAALWERVLKASVTAGAFLLLYTL
SQLTGLWVLYMLNGYRAFPAAHKVLDLLQYLLSTSDAYDQQMEIWRVESLLPLIATLFLG
VVILGTGTLFCIKTLVPGNQSCFPEDRRQSMSRQPSFTYSEWTDAKQEDFYELDAVPETP
VFDCFMDMKTEADPVTLTVKPVGLQERRGSNVSLTLDMCTPGTTEPYGALLSPREQSTQE
YLQNASNLLTPEQLHTRALDDGVLQAEFYETPMNFVDPKEYSIPGVVRKNRYKTILPNTH
SRVCLKAKEEGDFLSTYINANYLKGYGGKEKAYIATQGPTVNTVGDFWRMVWQERCPIIV
MITNIEEKNEKCTEYWPEDSVTCEGIEITVKQVIQADDYSLRIFTVKSEGEERSLRQYWY
TSWPDQKTPDKAPPLLELVQEVEEARKQAPPNSGPVIVHCSAGIGRTGCFIATSILCQQL
SNEGVVDILKTTSQLRLDRGGMIQTAEQYQFVHHVLSLYERQLRETSEE
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgtttttgagagcagcatggctgaagcccctgttggagaggacgcacccaaa
gagcaggacggtgccacctcacatgcccacgatccgctgccaggcattggtgctgctttg
tgggagcgagtattaaaagccagtgttacagctggagcttttctcctgctctacacactg
tctcaactcactggcttgtgggtcctttacatgctgaatggatacagggcttttccagca
gcacacaaagttttggatctccttcagtaccttctctctaccagtgatgcctatgatcaa
cagatggagatctggagggtggagagcttgctgcccctcatagccacactcttcttaggt
gtcgtcattcttggtactggaacgctgttctgcattaaaaccctggtgcctggcaaccag
tcctgcttccctgaagaccgtcgtcagtccatgagcaggcagccctcttttacatattca
gaatggacagatgctaaacaggaagatttctacgagctggacgctgttcctgaaactccc
gtgttcgactgctttatggacatgaaaactgaagccgaccctgtcactctcactgtcaaa
cctgtgggcttgcaggaaaggagaggctctaatgtgtctctgacgttggacatgtgcacc
cctggcactacagagccgtacggagcgctgctgtcacctagagagcagagcacacaggag
tatctgcagaacgcatccaacctgctgacccccgagcagctgcacacgagagcactggat
gacggcgtgcttcaggccgagttctatgagactcccatgaactttgtggacccaaaagaa
tatagtattcctggggtggtgaggaagaatcgctacaaaaccatactaccaaacacacat
agcagagtgtgcttaaaagctaaggaggaaggtgattttcttagcacctacatcaatgct
aattacttaaagggctacggtgggaaagaaaaagcatatatcgccacacagggtccgact
gtgaacacagtgggggatttctggaggatggtttggcaggagcgctgtcccattatcgtc
atgattactaacattgaagaaaaaaatgagaaatgcacagaatactggccagaggacagt
gtcacctgtgagggtatcgagatcactgtcaaacaggtcatccaggcagatgactacagc
ctaaggattttcactgtgaagagtgagggtgaggagcgctctctcagacagtactggtac
acgtcctggccagatcagaaaacaccagacaaagccccgcctcttctggagctcgtgcag
gaagtggaggaagcgagaaaacaggctccgccgaacagtggccctgtcatcgtccactgc
agtgcagggattggacgcactggctgtttcattgctacctccatcttgtgccagcagctt
agcaatgaaggggtggtcgacatcctcaagaccacaagccagctacgcttggacagaggt
gggatgatccagacggcggagcagtatcagtttgtccatcacgtcctcagcctgtatgaa
agacagctccgggagacctcagaggagtaa

DBGET integrated database retrieval system