KEGG   Danio rerio (zebrafish): 559878Help
Entry
559878            CDS       T01004                                 

Definition
ubiquitin carboxyl-terminal hydrolase 12-like
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     559878
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   559878
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 383 aa AA seqDB search
MEILMTVRKIASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFC
RPFREKVLAYKIQPRRKESLLTCLADLFNSIATQKKKVGVIPPKKFISRLRKENELFDNY
MQQDAHEFLNYLLNTIADLLQEEKSQERQQNGKVVQNGGSGSGGGGSGSSTGEGETEEKT
QQTWVHEIFQGTLTNETRCLNCEAVSSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCS
EYKYYCEQCRSKQEAQKRMRVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLF
NTSGDATNPDRLYDLVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEF
YGLTSDISKNSESGYILFYQSRD
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaaatactgatgacagtccgaaagatcgcctcgatttgtacgatgggcgccaatgcc
tctgctttggaaaaggagattggaccggaacaattccctgttaatgaacactactttggg
ctggtcaattttggcaacacctgctactgtaactcggtgctccaggcactgtacttctgc
cggcccttcagagagaaagtgttggcttataagatccagccgcggcggaaagagagtctg
cttacctgcctggctgacctgttcaacagcatcgccactcagaagaagaaagtgggagtc
attccaccgaagaaattcatctccagactgaggaaggaaaatgagctgtttgacaactac
atgcagcaagatgcacacgaattcctcaactacttgctcaacaccattgcagacctgctg
caggaggagaagagccaggagagacagcagaatggaaaggtagtacagaatggtgggagt
ggaagcggaggaggtggaagcggcagcagcacaggagaaggtgaaacagaggaaaagacc
cagcagacctgggtgcacgagatcttccaaggcacgctgaccaatgaaacacggtgcctg
aactgtgaagcggtgagtagtaaagacgaagacttcctagacctctcagtggatgtggag
cagaatacctccatcacacactgtctaagaggtttcagcaacacggagaccttatgtagt
gaatacaagtactactgtgagcaatgcagaagtaaacaagaggctcagaaaaggatgcgg
gtaaagaaattgcccatgatccttgccctgcacctaaagcgctttaagtatatggaccag
cttcatcgctacaccaagctatcttatcgtgtagtcttccctctggagctaaggctgttt
aacacctctggggatgctacaaatcctgaccgattgtacgatttggtggctgtagtggtg
cactgtgggagtggtccaaatcgaggtcattatatcactatagtgaagagtcacggcttc
tggcttttgtttgacgatgacattgtagagaaaatagatgcccaagcaattgaggaattc
tacggtctgacgtcggacatctccaaaaactcagagtcagggtatatactcttctaccag
tctagagactga

DBGET integrated database retrieval system