KEGG   Danio rerio (zebrafish): 560020Help
Entry
560020            CDS       T01004                                 

Gene name
acss2l, zmp:0000000720
Definition
acyl-CoA synthetase short-chain family member 2 like (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    560020 (acss2l)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    560020 (acss2l)
   00620 Pyruvate metabolism
    560020 (acss2l)
   00640 Propanoate metabolism
    560020 (acss2l)
Enzymes [BR:dre01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     560020 (acss2l)
Lipid biosynthesis proteins [BR:dre01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   560020 (acss2l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
2
AA seq 684 aa AA seqDB search
MSPVSNSTNTALSSPQEPEEKIYHPPDCIFTDAHVPDFDAYLALYKKSIEEPEEFWGDVA
QEFFWKKPPSGQMLQYNFNVTKGSVFIKFMDAAKTNICYNVLDRNVHERNLGDKVAYYWV
GNSPDHHLTITYNQLLRNVCRCANALKLLGVKKGDRVAIYLPMIPELVYTMLACARIGAV
HSIVFAGFSSESLCERIMDAQCNILVTADGGYRGDKLINLKKIASEALDRCKESSASSVQ
KCVVVKHPAFITSSDASSSLQTPWDELCDIWWDDLMDGVSDECEPEWMDSEDPLFILYTS
GSTGKPKGVVHTVTGYMLYTSLTFKYVFDYHHDDVYWCTADIGWITGHSYITYGPLANGA
TSVLFEGVPVHPHVGRLWEIIEKYGVSKFYTAPTAIRLLMKYGKEPLQRYDLSSLRVLGT
VGEPINPEAWLWYYDVVGQQRCPVIDTFWQTETGGHVLTPLPAATPLKPGSATCPFFGVQ
PAILNEHGEELEGEAEGYLVFRQPWPGIMRGVFGNQERFESTYFRKFPGFYVTGDGCRRD
KDGYYWITGRIDDMLNVSGHLLSTAEVESALSEHPSVAEAAVVSCPHAVKGECLYCFITL
KDQQEFNRTLMDELKRKVREKIGPIATPDFIQNAPGLPKTRSGKIMRRVLRQIARNEKEL
GDLSTLADPKVVEVLFSQRCEAAA
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccgtttcaaactccaccaacacggctctttcaagcccacaggagccagaggag
aagatttaccatccacccgactgtattttcactgacgcgcacgtgcctgactttgacgca
tatctggctttatataaaaagtccattgaagagcctgaagagttctggggtgatgttgct
caggagtttttctggaagaagcctccgtcgggacagatgttgcagtataacttcaacgtc
accaaggggagtgttttcatcaagttcatggacgcagcaaaaaccaacatttgctacaac
gtcctcgaccggaatgtgcacgagagaaacctgggagacaaagtggcttattactgggtg
ggaaactcacctgatcatcatctaaccatcacctacaaccagctgttgagaaacgtgtgc
cgatgtgccaatgctttaaagctgttgggggtgaagaagggggacagagtcgccatttat
ttacccatgattccagagctggtgtacaccatgctggcctgcgcgagaatcggggctgtt
cactctatagtgtttgcaggtttctcgtccgagtctctgtgtgaaaggatcatggacgct
caatgcaacatcctggtcacagcagatggtggttacagaggtgacaagctgatcaacctg
aagaagatagcgtctgaagctttggatcgctgtaaggaaagctcggcctcgtctgttcag
aagtgtgttgtggtcaaacatcctgccttcataaccagcagcgatgcttccagcagtcta
cagactccatgggatgaattgtgtgatatctggtgggatgacctgatggatggagtgtcg
gatgagtgtgaaccggagtggatggactctgaagatcctcttttcatactttacaccagc
ggctccaccggaaaacccaagggggtggtccacaccgtcacaggctacatgctctacaca
tcactgaccttcaaatatgttttcgattatcaccatgacgacgtttactggtgcactgca
gacattggctggatcacaggccactcctacatcacatatggcccgctggccaatggcgcg
accagtgtgctctttgaaggtgtgccggtccatcctcatgtgggcagactctgggagatc
attgagaagtatggagtctctaagttctacacggcgcccactgctataagactgctgatg
aaatatgggaaagaaccactgcagcggtatgatctgtccagcttgcgtgttttgggaacg
gttggtgaacccattaacccagaggcttggctttggtattatgatgttgtgggtcagcag
cgctgtccggttatcgacaccttctggcaaacagagacgggtggtcatgttctgactcct
ctaccagctgctacaccactaaaacctggatctgctacgtgcccattttttggagtccag
cctgccattcttaatgaacacggagaagaattagagggcgaagcggagggatacttggtt
ttccggcagccctggccgggaatcatgaggggtgtatttgggaatcaggagcgattcgag
agcacatacttcagaaaattcccaggattctacgtgacaggagacggctgcaggcgggac
aaggatggatattactggatcaccggccggattgatgacatgctgaatgtttctggtcat
ttgctgagcacagcagaggtggagtctgctctgtctgaacacccatcggtggctgaagct
gcagtggtcagttgtcctcatgcagtgaaaggagagtgtctgtactgctttatcactctg
aaagaccagcaagagttcaaccgcacgctgatggatgaactcaagaggaaagtgagggag
aagattggacccatcgccaccccagattttatccagaacgctccagggcttcccaaaacc
cgttcagggaagatcatgcgacgagttctacgacagatcgctcgcaatgaaaaagagctg
ggtgacctgtctacactggcggaccctaaagttgtggaggtgctgttcagccagagatgt
gaagcagcggcatga

DBGET integrated database retrieval system