KEGG   Danio rerio (zebrafish): 560068Help
Entry
560068            CDS       T01004                                 

Gene name
pdk3a, pdk3
Definition
pyruvate dehydrogenase kinase, isozyme 3a
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     560068 (pdk3a)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   560068 (pdk3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Position
24
AA seq 405 aa AA seqDB search
MRLYAFLLQNHLPKIEYYSRFSPSPLSIKQFLEFGRDNACEKTSYMFLRKELPVRLANTM
REVNLLPDRLLSQPSVKLVQKWYLQSFLELLEFENRKPEDGHALNDFLETLIEIRNRHND
VVPTMAQGVIEYKEKFGFDPFVSSNIQYFLDRFYTNRISFRMLINQHTLLFGNDINPAHP
KHIGSIDPSCNVAEVVTDAYETAKMVCEQYYQAAPELKIEEFNAAKAPQKPIQAVYVPSH
LFHMLFELFKNAMRATNDLHEGSKEGLPLIKAKVTLGIEDLSVKISDRGGGVALRKIDRL
FNYTYSTAPTPSLDSKRVPLAGFGHGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKAL
SSESFERLPVFNKSAWRHYQGGPGADDWSNPSKEPRDTSKYKAKR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagactgtacgcttttcttctgcagaaccatctaccaaagattgaatattattcgcgg
ttttcgccatcgccgctgtcaattaaacagtttctggaattcggtcgggacaatgcatgt
gagaagacgtcctacatgttcctgcggaaggagctgccggtgcgtcttgctaacactatg
agagaggtcaatctactgccggacagactcctcagtcaaccttcagtcaaactagtgcag
aaatggtacttgcaaagctttttagagcttctagagtttgagaacaggaagccagaagat
ggacatgccctgaatgacttcttagagactcttattgagatcaggaacagacacaatgat
gtggtcccaactatggcccagggtgtgatagaatataaggagaagtttggattcgatcca
ttcgtcagctccaacatccagtactttctggaccgcttctacaccaaccgaatttccttt
cgcatgctcatcaaccagcacactctcctctttggcaatgacatcaacccagcgcatccc
aaacacatcggcagtattgatcccagctgcaatgttgctgaagtggtgactgatgcctac
gaaaccgctaagatggtgtgtgagcaatattaccaagctgcccctgagctgaagatagaa
gaattcaatgcagcaaaggctcctcagaaacccatccaggcagtttatgtcccctcgcac
ctgttccacatgctgtttgaattgttcaagaatgcaatgcgagccaccaatgatcttcac
gagggcagcaaagagggtcttcctcttataaaagcaaaagtgaccctggggattgaggat
ctgtccgtgaagatcagtgacaggggagggggcgtggcattacggaagatcgacaggcta
tttaactacacctactcgactgcacccacacccagtctggactccaaacgagtgccgctg
gctgggtttggccatggtttgccgatctcaagactctacgcccgatactttcaaggagac
ctgaaactgtactcgatggaaggtgtggggactgatgccgtcatctatttgaaggccctc
tccagtgaatcatttgagcgtctgcccgtcttcaacaaatctgcatggcgtcactaccaa
ggaggcccaggagcagacgactggagcaacccgagcaaagagcccagagatacctccaaa
tacaaggccaagagataa

DBGET integrated database retrieval system