KEGG   Danio rerio (zebrafish): 560446Help
Entry
560446            CDS       T01004                                 

Definition
si:dkey-101k6.5
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    560446
   04350 TGF-beta signaling pathway
    560446
   04068 FoxO signaling pathway
    560446
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    560446
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    560446
  Cell communication
   04520 Adherens junction
    560446
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     560446
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   560446
Enzyme-linked receptors [BR:dre01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   560446
Cytokine receptors [BR:dre04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   560446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
9
AA seq 590 aa AA seqDB search
MGLWTRTSALLCCFCLLQVQSLSPIKTNLCKWCDHSSPVCEDNVCMSNCSLTSYCFLAEE
VCVAIWKKDNVSVSVRTLCYDPQHMLENIMLANYSSKECLMSPHPSEDGLLFICSCVGDQ
ECNDRLIFDKGPNGFSKLKSKDVIPVVVISLVPPLLVAVIATMAFYLYRTRQPGKKPKEW
GPRRTHYQSLDPAEGQANGIDFSAKRPSLSDDINSEMSSTCANNLNHNTEQLPIQLEALV
GKGRFAEVWRARLSHNESGQYETVAVKIFPAVEYSSWCNERAIFSDANLKHENVVQFLTA
EERGGTSATSQRQYWLIMAYYNMGNLQDFLVGNILTWAELCSLAGSVARGLAHLHSDTTP
CGIQKVPIAHRDLKSSNIVLKNQSECVLCDFGLALRLDLSLTVDDFANSGQVGTARYMAP
EVLESRVNLEDLESFKQIDIYSMALVMWEMVSRCDVIGEVKSYEPPFGSKVCEQPCVDSM
RDLVLRDRGRPDIPDSWTTHSGMQLLCATITECWDHDPEARLTAHCVVERFNTLAQEELE
NSICTHTPSTPPTEDQTPTLPSHPPCTDHSADICPHVTADIVSSRQHSQV
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgggtctgtggactcgaacatctgctcttctgtgctgcttctgtcttctgcaggtgcag
agtttaagccccataaagaccaacctgtgtaagtggtgtgatcactccagtcctgtgtgt
gaagacaacgtctgcatgagcaactgcagtctgacctcttactgctttctggctgaagaa
gtgtgtgtagccatatggaagaaggacaatgtgagcgtgagtgtgcggacgctgtgttat
gacccccagcatatgctggagaacataatgctggcgaattactcgtccaaggagtgtctg
atgagccctcatccatctgaagatggcctgctcttcatctgcagttgtgttggagatcag
gagtgtaacgacaggctcatctttgataaaggacccaatggattctcaaagctgaagtct
aaagacgtgattccagtcgtggtcataagcctggttcctcccctcttagtagcggtcatt
gcgaccatggctttttacctgtatcgcacacgtcagccaggcaaaaagcccaaggaatgg
ggaccacgacggacccactaccagtctcttgatcctgccgagggccaagctaatggcatc
gactttagtgccaagcggccatccctcagcgatgacatcaattcagaaatgtcatcgact
tgtgccaataatctaaaccacaacacggagcagctgcccatccagctggaggcgctggtg
ggtaaagggcgcttcgcggaggtatggcgggcacgacttagtcataatgaaagcgggcag
tatgaaacggtggctgtgaagatttttccagcagtggagtattcatcgtggtgtaacgaa
agagccatattctctgatgccaacttgaaacatgagaacgtggtgcagtttctgacggct
gaggagcggggcggtacgtctgccacctcccagaggcaatactggctcatcatggcttat
tataacatgggcaaccttcaagactttctggttgggaatattctgacatgggcagagttg
tgttcactagcaggctctgtggcaagaggactggcgcacctgcacagtgacacgacgcca
tgtggcatacaaaaagtgcccatcgcccatcgagatctgaagagcagcaacattgtgttg
aagaaccaaagcgaatgcgtgctctgtgatttcggcctggctctgcgacttgacctgtct
ctcactgtagatgatttcgccaacagtggacaggtgggaactgcccgctatatggcccca
gaagttctggagtccagggtgaatctcgaggacctggagtcctttaaacagattgatatc
tactccatggctctagtgatgtgggaaatggtctctaggtgtgacgtcataggagaggta
aagagttacgaacctccatttggctccaaagtgtgtgagcagccgtgtgtggacagcatg
agagacctggtgttgagagaccgaggaagaccagatattccagacagctggaccacacat
tcaggcatgcagttgttgtgcgcgactataacggagtgctgggatcacgacccggaggct
cgactgacggctcactgcgtggtggagcgctttaacactctggctcaggaagagctggag
aactccatctgcacccacacaccctcaacaccacctacagaagaccaaaccccgaccctg
ccctctcacccaccctgcacagaccacagcgctgacatctgtccgcacgtcacagctgac
atcgtttcctccaggcaacatagtcaagtttaa

DBGET integrated database retrieval system