KEGG   Danio rerio (zebrafish): 560446Help
Entry
560446            CDS       T01004                                 

Definition
si:dkey-101k6.5
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Adherens junction
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:dre04010]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:dre04350]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dre04068]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:dre04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:dre04144]
Cellular Processes; Cell communication; Adherens junction [PATH:dre04520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
9
AA seq 590 aa AA seqDB search
MGLWTRTSALLCCFCLLQVQSLSPIKTNLCKWCDHSSPVCEDNVCMSNCSLTSYCFLAEE
VCVAIWKKDNVSVSVRTLCYDPQHMLENIMLANYSSKECLMSPHPSEDGLLFICSCVGDQ
ECNDRLIFDKGPNGFSKLKSKDVIPVVVISLVPPLLVAVIATMAFYLYRTRQPGKKPKEW
GPRRTHYQSLDPAEGQANGIDFSAKRPSLSDDINSEMSSTCANNLNHNTEQLPIQLEALV
GKGRFAEVWRARLSHNESGQYETVAVKIFPAVEYSSWCNERAIFSDANLKHENVVQFLTA
EERGGTSATSQRQYWLIMAYYNMGNLQDFLVGNILTWAELCSLAGSVARGLAHLHSDTTP
CGIQKVPIAHRDLKSSNIVLKNQSECVLCDFGLALRLDLSLTVDDFANSGQVGTARYMAP
EVLESRVNLEDLESFKQIDIYSMALVMWEMVSRCDVIGEVKSYEPPFGSKVCEQPCVDSM
RDLVLRDRGRPDIPDSWTTHSGMQLLCATITECWDHDPEARLTAHCVVERFNTLAQEELE
NSICTHTPSTPPTEDQTPTLPSHPPCTDHSADICPHVTADIVSSRQHSQV
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgggtctgtggactcgaacatctgctcttctgtgctgcttctgtcttctgcaggtgcag
agtttaagccccataaagaccaacctgtgtaagtggtgtgatcactccagtcctgtgtgt
gaagacaacgtctgcatgagcaactgcagtctgacctcttactgctttctggctgaagaa
gtgtgtgtagccatatggaagaaggacaatgtgagcgtgagtgtgcggacgctgtgttat
gacccccagcatatgctggagaacataatgctggcgaattactcgtccaaggagtgtctg
atgagccctcatccatctgaagatggcctgctcttcatctgcagttgtgttggagatcag
gagtgtaacgacaggctcatctttgataaaggacccaatggattctcaaagctgaagtct
aaagacgtgattccagtcgtggtcataagcctggttcctcccctcttagtagcggtcatt
gcgaccatggctttttacctgtatcgcacacgtcagccaggcaaaaagcccaaggaatgg
ggaccacgacggacccactaccagtctcttgatcctgccgagggccaagctaatggcatc
gactttagtgccaagcggccatccctcagcgatgacatcaattcagaaatgtcatcgact
tgtgccaataatctaaaccacaacacggagcagctgcccatccagctggaggcgctggtg
ggtaaagggcgcttcgcggaggtatggcgggcacgacttagtcataatgaaagcgggcag
tatgaaacggtggctgtgaagatttttccagcagtggagtattcatcgtggtgtaacgaa
agagccatattctctgatgccaacttgaaacatgagaacgtggtgcagtttctgacggct
gaggagcggggcggtacgtctgccacctcccagaggcaatactggctcatcatggcttat
tataacatgggcaaccttcaagactttctggttgggaatattctgacatgggcagagttg
tgttcactagcaggctctgtggcaagaggactggcgcacctgcacagtgacacgacgcca
tgtggcatacaaaaagtgcccatcgcccatcgagatctgaagagcagcaacattgtgttg
aagaaccaaagcgaatgcgtgctctgtgatttcggcctggctctgcgacttgacctgtct
ctcactgtagatgatttcgccaacagtggacaggtgggaactgcccgctatatggcccca
gaagttctggagtccagggtgaatctcgaggacctggagtcctttaaacagattgatatc
tactccatggctctagtgatgtgggaaatggtctctaggtgtgacgtcataggagaggta
aagagttacgaacctccatttggctccaaagtgtgtgagcagccgtgtgtggacagcatg
agagacctggtgttgagagaccgaggaagaccagatattccagacagctggaccacacat
tcaggcatgcagttgttgtgcgcgactataacggagtgctgggatcacgacccggaggct
cgactgacggctcactgcgtggtggagcgctttaacactctggctcaggaagagctggag
aactccatctgcacccacacaccctcaacaccacctacagaagaccaaaccccgaccctg
ccctctcacccaccctgcacagaccacagcgctgacatctgtccgcacgtcacagctgac
atcgtttcctccaggcaacatagtcaagtttaa

DBGET integrated database retrieval system