KEGG   Danio rerio (zebrafish): 560455Help
Entry
560455            CDS       T01004                                 

Gene name
rptor
Definition
(RefSeq) regulatory-associated protein of mTOR isoform X1
  KO
K07204  
regulatory associated protein of mTOR
Organism
dre  Danio rerio (zebrafish)
Pathway
Autophagy - other
Autophagy - animal
mTOR signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    560455 (rptor)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    560455 (rptor)
   04136 Autophagy - other eukaryotes
    560455 (rptor)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    560455 (rptor)
Membrane trafficking [BR:dre04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    560455 (rptor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Position
6
AA seq 1363 aa AA seqDB search
MKMDAELLHSPVLGLAEEEEVDMTDWNLPLAFMKKRHTEKIEGYKALAQSWRMKDRMKTV
SVALVLCLNVGVDPPDVVKTSPCARLECWIDPLSMSPQKALETIGANLQKQYENWQPRAR
YKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLS
VYDLQTWMGSPSIFVYDCSNAGIIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMK
NCIQLAACDASELLPMNPDLPADLFTSCLTTPIKIALRWFCMQKSAKLVPGVTLDLIEKI
PGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMR
SYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQV
WLSMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLK
LLQSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPFMPAEHRTMAVFI
LAVIVNNYNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNYDSARWCGVRD
SAHEKLYSLLSDSIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPI
VRKELVVALSHLVVQYESNFCTVALQFMEEEKNYAVPSPANSTETGNITPSRDSPAIPRL
RSVNSYTNLRAATTARTLNKSLQNLNLNEEGGPAAFSPGNLSTSSSASSTLGSPDNDEYL
LSFETIDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPFPDVSDLAMKVLNSIA
YKATMNARTQRILDSGSLTQSAPASPTSKGTLIHQAGASHRSKCSSSPSSGSPPMPGASS
SSLTNEVPKPPVRDGPSARPPYTPTLGGQAPHSQQFPRTRKMFDKGPDQTAEDGDETAVH
RSFVSLSLQTGLCDWSAKYFAQPVMKIPEEHDSESQVRKDREWRFLRNARVRKQSQRITQ
RGVTRLDDQIFINRNPGVPSVVKFHPFNPCIAVADKDSICFWDWEKGERLDYFYNGNPRY
TRITAMEYLNGHDCSLLLTATDDGALRIWKNFADQRNPEMVTAWQGLSDMLPTTRGLARR
VSIYLDRSKQGGAGMVVDWEQETGLLMTSGDVRVIRIWDTEREIKVQDIPTGADSCVTSL
SCDPQRSLVAAGLGDGSVRVYDRRMGPNECRVMTYREHGAWVVKAHLQKEPEGHIISVSV
NGDVRFFDPRMPESVNTLQTVKGLTALDIHPQANLFACGSMNQFIAVHNSNGDVISNIKY
YDGFMGQRIGAISCLAFHPFWPHLAVGSNDYYMSIYSAEKRLR
NT seq 4092 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggatgctgagctgcttcactcccctgtcttgggtctggcagaggaggaggag
gtggacatgactgactggaaccttccactggccttcatgaagaaacgccacacagagaag
attgagggatataaagctttggctcagagctggagaatgaaagacaggatgaaaacagtg
agtgtggctctagttttatgtctgaatgttggtgtggaccctcctgatgtagtgaagacc
tcaccctgtgccagactggagtgctggatagaccctctatccatgagtccacagaaagcg
ctggaaacaataggagctaacctccagaaacagtatgagaactggcagcccagggcccgg
tataagcagagtttggaccctacagttgatgaagtaaagaagttgtgtacttcactacgc
agaaatgccaaggaggaacgtgttctctttcactataatggtcatggggtgcctcgacct
actgttaatggagagatctgggttttcaacaagaactatacccagtacatcccactctct
gtctatgacctacagacatggatgggaagtccctccatctttgtgtatgactgttctaat
gcaggcatcatcgtaaagtcattcaaacagtttgcattgcagagggagcaggagctggag
gtggcagcaataaacccaaaccacccactagctcagatgcctctgcctccctcgatgaaa
aactgcattcagctggctgcctgtgatgccagtgaactcctacccatgaatcctgacctc
cctgctgacctcttcacttcttgtctcaccacaccaatcaaaattgctctacgctggttt
tgtatgcagaagagtgcaaagctggtgccaggagtgacgttagacctgattgagaagata
ccaggaaggctgaatgacaggaggacacctttaggagagctgaactggattttcacagct
atcactgacacaattgcatggaatgtcctaccgagagatctctttcagaaattatttcgt
caggatctcttggtggccagtttatttcgcaatttcctattggctgagagaattatgagg
tcatataactgtacaccagtcagcagccccaggttgccacccacatacatgcatgctatg
tggcaagcatgggacctggcggtggacatttgcctttcccagctgcccaccatcattgag
gaaggcactgctttcaggcacagtccattctttgctgaacaactgacagcctttcaggtg
tggctgtcaatgggtgtggagaacagaaacccaccagagcagctgcctatcgtcctgcag
gtccttttaagtcaggtacacaggctgagggcgctggatttgcttggacgatttttggac
ctgggtccttgggctgtcagtttggctctttcagtaggaatttttccatatgtgctaaaa
ctgttgcagagttcagcgagagagctgaggcctcttttggtcttcatctgggcaaagatc
ctggctgtagatagttcatgccaggctgatcttgtaaaagataatggacacaagtatttc
ttgtcagtgctggctgatccgttcatgccagctgagcatcgaactatggctgtcttcatt
cttgctgtcattgttaataactataacacaggacaggaggcatgtctgcagggtaacctg
attgcaatctgtctggaacagctcaatgaccctcaccctctcctgaggcaatgggttgca
atatgtcttggacgaatttggcagaactatgattctgctcgctggtgcggagttcgagat
agtgcacatgaaaaactctacagtctcctgtcggattctataccagaggtacgatgtgca
gctgtgtttgcactgggcacatttgtggggaattcagctgagagaacagatcattctacc
accattgatcataatgtggccatgatgcttgcacaactgattaatgatggcagtcccatt
gtgaggaaggagctggttgttgctctaagtcacttagtggtccagtatgagagtaatttt
tgcactgtggctctgcagttcatggaggaagagaagaattacgctgtgccttcacctgcc
aattccacagaaacaggaaacattactccaagtagggacagtcctgccattcctcgttta
agatcagtgaactcctacacaaacctcagagctgccaccactgctcgaacccttaataag
agccttcagaacctcaacctaaatgaggagggtggtccggcagcattttctccagggaac
ctgagtaccagtagcagtgccagcagcactctgggcagtcctgataatgatgaatacctt
ctctcctttgaaaccatcgacaagatgagaagagtcagctcatactcatccttaaattct
ctcattggagtgtcttttaacagtgtttatactcagatttggagggtattactacatctt
gcagctgatccatttccagatgtctctgatctggccatgaaggttctcaacagcattgca
tacaaggccaccatgaatgctcgcacacaaagaattttggactcaggatctctgacccag
tcagctccagccagccccaccagtaaaggcacactaattcatcaagctggtgcttcccac
agatccaaatgctcttcatctccctccagcggatctccacccatgcctggtgcatccagc
tccagtctcaccaatgaagtgcccaagccaccggtccgggacggtccatctgctcggcca
ccatacactccaacactaggtggtcaggcaccccactcacagcagtttccacgcaccagg
aagatgtttgataagggccctgatcagactgctgaggatggagatgagactgctgttcac
aggagcttcgtcagtttgagtctgcagacaggtctttgtgactggagtgccaaatacttt
gctcagcctgtcatgaagattccagaagagcatgattcggagagtcaggttcgtaaggat
agggagtggagattcttacgtaatgctcgagtacgcaaacaaagccaacgcatcactcaa
agaggagtgacaaggttagatgaccagatcttcatcaacagaaacccaggagtgccatca
gtggtaaagtttcatccatttaacccctgcattgctgtagctgacaaagactcaatttgt
ttttgggactgggaaaaaggagagaggttggattatttttataatggcaacccacggtac
acgcgcatcacagccatggagtaccttaatgggcatgactgctctcttctcctcactgcc
acagatgatggagcattgcgaatttggaagaactttgctgaccagagaaatccagagatg
gtcacagcatggcaaggcttgtctgacatgctgcccaccacacgaggtttagctcgacgg
gtctcaatatatcttgacagaagtaagcaggggggtgcaggtatggtggtggactgggag
caggagactggcctcttgatgacgtctggtgatgttcgagtcatacggatctgggacaca
gaaagagaaataaaagttcaggacatcccaacaggagcagacagttgtgtaaccagcctg
tcatgtgatcctcagcggtcattagtagccgcaggccttggagatggatctgttcgagtg
tatgatcgaagaatgggacctaatgagtgtcgtgtgatgacttacagggaacatggagct
tgggtggttaaggcacacttgcagaaagagccggaaggacacattatcagtgtcagtgta
aatggagatgtgcggttctttgacccacggatgccagaatcagtcaacaccttgcaaaca
gtgaaaggactgacagccctagacatccatccacaggcaaatttgtttgcttgtggctct
atgaatcagtttatagctgtgcataactctaatggggatgtgatcagcaacattaaatac
tatgatggttttatggggcagagaattggagccatcagctgcctggcctttcaccctttc
tggcctcatcttgcagtgggcagtaatgattactacatgtccatctactcagcggagaag
agactcagatga

DBGET integrated database retrieval system