KEGG   Danio rerio (zebrafish): 560482Help
Entry
560482            CDS       T01004                                 

Gene name
rad54b, im:7137737, im:7153525
Definition
RAD54 homolog B (S. cerevisiae)
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
dre  Danio rerio (zebrafish)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    560482 (rad54b)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     560482 (rad54b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
16
AA seq 917 aa AA seqDB search
MRRSGAPSQLRGNAAKKPRFMPPGPARNDGAPCLDPQPEPSQPSPPPIPALKNVLLNKVQ
RCLSSGDAPAASDAPVGSKALARVLGAAVPQGECKENHIRSMPDFPEPEESVNKDRRSPP
LNTHASCTTTAHYYSVIWCKASSRKHKRWEGDAVLVARGRTVVLKDMEGRDIGRGSGYKA
SELESLCEGQTLMVGGKQIEVMGVISDQDYAKGRCFQDAAVEIPAESPTVSKTPAYRPVS
KSFTKPALKGGALTDSELDKPICKPRYDPNAPGALVMPRPTADHQWQYNKSGAPLVDVVI
DPHLTNHLRPHQKEGVVFLYECLMGMRLAGRCGAILADEMGLGKTLQCVCVLWTLLRQGP
YGGRPVMKRALVVCPGSLVKNWAAEFNKWLGRERISVYTVDQDHRVEDFVSSPLCSVLVI
SYEMLLRSVDRLKELDFGVLICDEGHRLKNSNIKTAGALTALSCTRRLILTGTPVQNDLQ
EFYSIIEFVNPGILGTSAAYRKIYEEPILRSRQPSCTEEERCIGEERAAELFRLTGVFTL
RRTQEIINQYLSERIEWTVFCKPTELQIRLYRVLLSTRPIRACLSGSHTYTHSPHLVCIN
ALKKLCNHPALLYNTLQEKADEMYEGEVKELFPEEYSTGAFSTADSGKLLVLTDLLSAIQ
HVNRTDRVVLVSNHTQTLDLLQDVCDQIGYKWCRLDGQTPVGQRQKIVDSFNSPHSSSFL
LLLSSKAGGVGLNLIGASHLVLYDIDWNPANDIQAMARVWRDGQKKTVHIYRFLTTGSIE
EKIYQRQVSKQGLSGTVVDLTKKAEHISFSAEELRDLFRFDPNTTCLTHDLLNCKCSGDG
NTPGSVKESSEDTGRSCQLGRQADNAISVPQRVSMSELMHWRHFSGAVQSYGDIYLNQAC
NHITYAFQSTSKSKTTV
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagatctggagctccgagtcagctccgtggaaatgctgctaagaaacccagattt
atgccaccgggtccagcgaggaatgatggagcaccttgtttggatccccaaccagaacca
tcacaaccctcaccgcctcccatacctgctttaaaaaatgtgctgctcaataaggtccag
aggtgtttgagtagtggagatgctccagctgcaagtgatgctccagtaggaagtaaggca
ctagccagggtccttggtgctgcggttcctcagggggaatgtaaggaaaaccacatcagg
tctatgcctgactttcctgaacccgaagaatcagtaaataaagacaggcgctcaccaccg
ctaaacactcatgctagctgcacaacaactgctcactactatagtgttatatggtgcaag
gcctcttcaaggaagcataagcgctgggaaggtgatgctgtgcttgttgccagagggcga
acggttgtccttaaagacatggagggccgggacattggacgaggttcaggttacaaggca
tcagagctggagagtttgtgtgagggtcagactcttatggttggagggaagcaaatagag
gtcatgggggtcatatctgatcaagactatgccaaaggccgctgtttccaagatgcggct
gtcgagattcctgcagaaagccctacagtctcgaagactcctgcatatcggccggtatcc
aaatcctttaccaagccagcgctcaagggaggcgcacttacagattctgaacttgacaaa
ccaatctgtaaacctcgatatgacccgaacgcaccaggagccctggtgatgccacggcct
acagcagatcaccagtggcagtataataaatctggagctccactggttgacgtggtcatc
gaccctcacttgaccaatcaccttcggccacatcagaaagagggcgtggtcttcctttac
gaatgcttaatgggaatgagattggctggccgctgtggggcgattctagcagatgagatg
ggattggggaaaactctgcagtgtgtttgtgttttgtggacattactcaggcaggggccc
tatggtggacgtcccgtaatgaaaagagcacttgtggtttgtcctggaagtttggtgaag
aactgggctgctgagttcaacaagtggctgggcagagagagaatcagtgtttacaccgtg
gaccaggatcaccgtgtggaagactttgtttcttctcctctttgctccgtcctggtcatc
agctatgagatgttgttgcgctctgtggaccggctgaaagaactggattttggagtcctc
atctgtgacgaaggtcatcgcctaaaaaacagcaacatcaaaacagctggagctctcaca
gccctctcatgcacacgccggcttattttaacaggtactccggtgcaaaatgatctgcag
gagttttattcaatcatcgagtttgtaaatccaggaattctgggaacatctgcggcctac
aggaagatttatgaagagcccattctccgatctcgccagcccagctgcaccgaagaagag
cggtgtattggagaagagcgtgctgctgagctctttcgtctgacaggtgtctttacatta
cgccgcactcaggagatcattaatcagtatttatctgagcggatcgagtggactgtgttc
tgcaaacccaccgagctgcaaattcgtctgtacagggtacttctgtccacgcgacccata
agagcctgtttgtctggctctcacacttacacacacagccctcaccttgtatgcatcaac
gcccttaagaaactctgcaaccaccctgcactgctctacaacacactacaggaaaaggca
gatgagatgtatgagggtgaagttaaggagctctttcctgaggaatactccaccggcgcc
ttcagcacagcagactctggcaaacttttagtgttaacagaccttctgtcagccatacag
catgtcaatcgcacagacagggttgttttggtgtccaaccacacacagactcttgactta
ctccaggacgtctgtgatcagataggctataaatggtgtcgtcttgatggacagacacca
gttggccagcggcagaaaattgttgattccttcaacagcccacattcgtccagctttcta
ctgctgctcagctccaaagctggaggagtgggactaaacctcatcggtgcctctcacctc
gttttatatgatatagactggaatcctgccaatgacatacaggccatggcacgagtgtgg
agagatggacagaagaaaacagttcatatctacagatttctcacaacaggttccatagaa
gagaagatttatcagaggcaggtgagtaaacaagggctttctgggacagtggtggacctg
accaaaaaagctgagcatattagcttttcggctgaggagctgcgagacctttttaggttt
gaccctaataccacctgcctcacacatgacttactgaactgcaagtgctctggagatgga
aatacaccaggttctgtgaaggagtccagtgaggacactggaaggtcatgtcagctgggt
cgccaagccgacaacgcaatatcagtcccacagcgagtcagcatgtctgagctcatgcac
tggaggcatttttcaggagctgttcaatcatatggtgatatttacctaaatcaggcctgt
aaccacattacatatgcctttcaaagcacttctaaatccaaaaccacagtctaa

DBGET integrated database retrieval system