KEGG   Danio rerio (zebrafish): 560649Help
Entry
560649            CDS       T01004                                 

Definition
(RefSeq) si:ch211-214p16.3
  KO
K14621  
phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    560649
   00565 Ether lipid metabolism
    560649
   00590 Arachidonic acid metabolism
    560649
   00591 Linoleic acid metabolism
    560649
   00592 alpha-Linolenic acid metabolism
    560649
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     560649
    3.1.1.5  lysophospholipase
     560649
Membrane trafficking [BR:dre04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    560649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
17
AA seq 1001 aa AA seqDB search
MLSEILSTFNPHISAVLPDQRSLMEKAEDMQFLDPTQWKLLLLFIPVDEISVCPDQDLTA
VIDETVNRVEQTLDSLNEKLKHTLVHVVVWRGLSSDRVCQFKCEQGYDENKCRLDMLVLM
ASLQESLSALLERRGWFNDQEDFSVMLQSSPVLTDPMTLPSPDSSNDISLVVLQLWANLL
QPITDNTEMDGWGGVTVPCPTEEKPFLRTHQNSESRSSQTADSPLLVDPVMGSELNCEDM
APSPSIPTSVHALRPADIKVVAAIGDSLTAANGVGAAQNNLLGVITEYRGLSWCIGGDKN
LSSITTLPNILKEFNPSINGYSVGKGDEDSAQSFLNQAVPGAKADDMVKQAHAVIKRMKE
DSRIDFENDWKIITLFIGGNDLCAHCSDTRYYSSDNIVKYIREALDILHNEVPRALVNLV
ELLDIVPLRALHKDKSNGCPTWLVNIMCRCVLQPKDESHEFQTLQEFNKAYQRGMWELVD
SGRYDTHDNFTVVLQPFLRNVFLPLMEDGRPDRSYFSPDCFHLSQKAHTLMARALWNNLM
EPLGNKTDKEDFTAGISLKCPERSSPYLRTFHNSNYTYNIPEPSPPPPTNWGSDFSCVDT
APSNTLPTSVHSLRPGDIKVVAALGDSLTAGFGAKAKNILQLPDEERGVSWSIGGDDTLE
TVTTLPNIFKKFNPSVFGFSKGKSKRPNGFNMAVGGAKAQNIPAQARDLITALKESKDVD
FEKDWKLVTLFIGGNDLCQYCHDRAALSSSKYIGHIRDSLDMLYNEVPRVLVNLVEILQI
EDLRMIKRDTLGCSLLQKNMCPCFLSPRENSPQMNEMKKVNRDLQAEAERLVYGGRYDGR
HDFAVVLQPFFENTVVPMDKDGKPDVSFFSVDCFHFSERGHAEMAIAIWNNMLEPVGSKQ
NYNNFTYDRSKIRCPTEEHPFIFTRINSGPEVPMTTVPTTVLPGTPLPADCANDVVPAWA
AAVLAVGGLMIGWIVTWMIFYYRERRNRKRNQINEMSGTKF
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctgaaatattgtccacctttaaccctcatatatcagctgttctacctgaccaa
aggagtttaatggaaaaagcagaagacatgcagttcctggaccccactcagtggaagttg
ctccttctattcataccagttgatgagatctctgtgtgcccagaccaggatctcactgca
gtcattgatgaaacagttaacagagttgagcaaacactggactctcttaatgagaagttg
aaacacacattggttcatgttgtggtttggcgtggactgtcaagtgaccgagtctgtcag
ttcaaatgtgagcaaggatatgatgaaaacaaatgtagactggatatgttagtgcttatg
gcttcattgcaggaatctctcagtgctctcttagaaaggagaggctggttcaacgatcaa
gaggacttcagtgtaatgcttcagtccagtccagtgctgacagatccaatgacattaccc
tcgcctgactcctcaaatgacataagcttggttgttttacaactctgggctaatttgctc
cagccaatcacagacaacactgagatggatgggtggggcggagtcaccgttccatgtcct
actgaggaaaagccatttttgcgaacacatcaaaattcagagtccagatcatcacaaaca
gcagattcacctctacttgtcgacccagtgatggggagtgaactcaactgtgaggacatg
gctccatctcccagcatccctacctcagttcatgctttacggccagcagacatcaaagtt
gtggcagcgataggtgactctttaacggcagccaatggggtaggtgctgctcaaaataac
ctgctgggtgtgatcacagagtaccgaggcctgtcatggtgcattggtggagataagaac
ctgtcatctataaccactttaccaaacatactgaaagagtttaacccttcaatcaatggc
tattctgtgggaaaaggagatgaggattcagcacaaagctttctgaaccaagcagtacca
ggagccaaagctgatgatatggtgaagcaggctcatgctgttattaaaagaatgaaggaa
gactcaagaattgatttcgagaacgactggaagattatcacactcttcattggaggaaat
gacttatgtgcccactgctctgatactcggtactattcttctgataacattgtgaagtat
atccgcgaggctctggacattttgcacaatgaggttcctcgagctctggtaaacctcgtg
gagctgctggatatagttccccttcgtgcacttcataaggacaaaagcaatggttgccct
acctggctggtcaatattatgtgccgttgtgttctgcaacctaaagatgaatctcatgaa
ttccagacattgcaggagtttaacaaagcctatcagcgtgggatgtgggagctggtggat
tctggccgatatgacactcatgataatttcactgtggtcctgcagccattcttgagaaat
gtttttcttcccttgatggaggacgggagacctgaccgatcttatttctctccggactgt
tttcatctcagtcagaaagctcacacgctcatggctcgggctctctggaacaacctgatg
gaacctttaggtaacaagactgataaagaggatttcactgcaggaatctctcttaaatgc
ccagaaagatcatccccctatttgaggacatttcataacagcaattacacatacaacatt
cctgaaccttctcctccacccccaacaaactggggaagtgatttctcatgtgtggacaca
gcgccctctaacactttaccaacatctgttcacagtctgcgtccaggtgacatcaaagta
gtggcggctcttggagactcactcactgccggatttggtgcaaaagctaaaaacattctc
cagctgccggatgaggaacgcggggtttcctggagcattggtggagatgatacattggag
actgtcaccacattaccgaacatcttcaagaagttcaacccaagtgttttcggcttctcc
aaggggaaaagtaaacgaccaaatggctttaatatggcagtgggcggtgccaaagcacag
aatataccagcacaagcaagggatctcatcacagctttgaaggaaagcaaggacgtggac
tttgagaaggattggaaactggtgacattgtttattggaggaaatgacctttgccagtac
tgtcatgaccgggctgctctgtcttcttcaaagtatatcggtcacatcagagacagtctg
gacatgctctacaatgaggttcccagagtgctggtgaatttagtggaaatcttacagatt
gaggatctgcgaatgataaagagggacacactgggctgcagcctcctccaaaaaaacatg
tgtccgtgttttctgagtccacgtgaaaactctccacaaatgaatgaaatgaagaaggtc
aacagagatctgcaggcggaggctgaaaggctggtgtatgggggacggtatgatggaaga
catgactttgcggtggtgctacagcccttttttgagaacactgttgttccaatggacaag
gatggcaaaccagacgtgtctttcttttctgtggattgttttcatttttctgagcgtggc
catgcagagatggctattgcaatttggaacaatatgctggagcctgtagggagtaaacag
aactacaataatttcacatatgaccgcagtaagatccgctgtcccacagaggagcatccc
ttcatcttcacacgaataaacagtggccccgaggttcctatgacaacagtacccaccaca
gtcctaccgggcacccctttgcctgctgattgtgccaatgatgttgtgccagcctgggca
gctgcagttctggctgtaggaggattgatgattggctggatcgtaacctggatgatcttc
tactatagagaacgacgaaacagaaaaagaaaccagatcaatgaaatgagtggaacaaag
ttctaa

DBGET integrated database retrieval system