KEGG   Danio rerio (zebrafish): 560717Help
Entry
560717            CDS       T01004                                 

Gene name
srd5a3, S5AR_3, fj40g12, si:ch211-278f21.3, srd5a2l, wu:fj40g12
Definition
steroid 5 alpha-reductase 3 (EC:1.3.1.22 1.3.1.94)
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
dre  Danio rerio (zebrafish)
Pathway
Steroid hormone biosynthesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:dre00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 309 aa AA seqDB search
MFHILSIVNIIWLLLALCFGAAFCLNKFSVKLPNRVEHVFQDFIRYGKTKENIKRASWQL
VFDLSKRYFYHFYVVSVMWNGLLLLFSIRSVVMSEAFPDWIIDVLGSLTGRSRGAWNEIH
LSTLLLQVLLWVHTLRRLLECLFVSVFSDGVINVVQYAFGLSYYIILGLTVLCTNDSLPQ
SESVSFFNQLTWYHVVGTLLFFWASFLQHQSLSLLAKMRTDSSGKVETLAHKMPCGGWFE
LVSCPHYLAELLIYAAMCVCCGCASLTWWMVVLYVLCNQALAAQLCHEYYRSKFKTYPHH
RKAFIPFVL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatattttaagtatagttaatataatatggcttttgttagcgctatgttttggt
gcagccttttgcctcaataagttttcagtgaaactgcctaacagagtcgagcacgtgttc
caggattttatccggtatggaaaaactaaggaaaacatcaaacgcgctagctggcagctc
gtttttgacttatcaaagaggtatttctatcatttctatgtggtgtctgtcatgtggaat
gggctcctcctactgttttccatacggtctgtcgtaatgtctgaggcgttccctgattgg
atcattgacgtacttgggagtttgactggcagatcaaggggtgcttggaacgagatacat
ctgtccactctgcttttacaagtgctcctatgggttcatacactaagacgactgttggag
tgcctgtttgtcagcgtattctctgatggtgtgatcaatgtggttcaatatgcatttggc
ttgagttattatatcatacttggactaactgtgctgtgtacaaatgattctcttccacag
tcagagtcagtttctttctttaatcagctaacatggtatcatgtagtcgggactcttctc
ttcttctgggcctcatttctccagcaccagtccctctctctgctggccaagatgaggact
gacagctcaggtaaagtagagactctggcccacaagatgccgtgtggcggttggtttgag
ctggtctcttgtccacattacctggctgagcttctgatttatgctgccatgtgtgtttgc
tgtggatgtgcttcactaacctggtggatggtggtgctgtacgttctctgtaaccaagca
cttgctgcacagctctgtcatgagtactacaggagcaagtttaagacatatccacatcac
cgaaaagctttcatcccttttgtcctgtga

DBGET integrated database retrieval system