KEGG   Danio rerio (zebrafish): 560753Help
Entry
560753            CDS       T01004                                 

Gene name
tpi1b, DrTPI-B, cb179, wu:fb51c02
Definition
triosephosphate isomerase 1b (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    560753 (tpi1b)
   01230 Biosynthesis of amino acids
    560753 (tpi1b)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    560753 (tpi1b)
   00051 Fructose and mannose metabolism
    560753 (tpi1b)
   00562 Inositol phosphate metabolism
    560753 (tpi1b)
Enzymes [BR:dre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     560753 (tpi1b)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   560753 (tpi1b)
  Exosomal proteins of bladder cancer cells
   560753 (tpi1b)
  Exosomal proteins of melanoma cells
   560753 (tpi1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
16
AA seq 248 aa AA seqDB search
MSGRKFFVGGNWKMNGDKKSIEELANTLNSAKLNPDTEVVCGAPTIYLDYARSKLNPNID
VAAQNCYKVAKGAFTGEISPAMIKDCGVKWVILGHSERRHVFGESDELIGQKVAHALENG
LGVIACIGEKLDEREAGITEKVVFAQTKFIADNVKDWSKVVLAYEPVWAIGTGKTASPQQ
AQEVHDKLRQWLKTNVSEAVANSVRIIYGGSVTGGTCKELASQKDLDGFLVGGASLKPEF
IDIINAKA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcaggaagtttttcgtcggtggaaactggaaaatgaacggcgacaaaaagagc
atcgaagagctcgccaatacactgaatagcgccaagctcaacccagacaccgaggttgtg
tgtggcgctccaaccatctacctagactacgccaggtctaagctcaatcctaacattgat
gtggctgcacagaactgctacaaggttgcaaagggagctttcaccggagagatcagccct
gccatgattaaggactgcggagtaaaatgggtgattctgggacactcagagagacgccac
gtgtttggagagagtgatgagctgatcggccagaaggtggctcatgctcttgagaatggt
ttgggagtgatcgcctgcattggtgagaagctggatgagcgggaggctggaatcacagag
aaagttgtttttgcacagaccaagttcatcgcagataacgtgaaggactggagcaaagtg
gttcttgcttacgaacctgtatgggccattggcactggtaaaactgcatcacctcagcag
gctcaggaggtgcatgacaagctccggcagtggttaaagaccaatgtctcagaggctgtc
gccaactccgtcaggatcatttacggaggttcggtcactggaggaacctgcaaggaactg
gcttctcagaaagacctggacggattccttgtcggcggagcttctctaaaaccagagttt
atcgacattattaacgcaaaagcataa

DBGET integrated database retrieval system