KEGG   Danio rerio (zebrafish): 560807Help
Entry
560807            CDS       T01004                                 

Gene name
adcy6b
Definition
(RefSeq) adenylate cyclase type 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre04114  Oocyte meiosis
dre04261  Adrenergic signaling in cardiomyocytes
dre04270  Vascular smooth muscle contraction
dre04371  Apelin signaling pathway
dre04540  Gap junction
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04916  Melanogenesis
Module
dre_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    560807 (adcy6b)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    560807 (adcy6b)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    560807 (adcy6b)
  Cellular community - eukaryotes
   04540 Gap junction
    560807 (adcy6b)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    560807 (adcy6b)
   04914 Progesterone-mediated oocyte maturation
    560807 (adcy6b)
   04916 Melanogenesis
    560807 (adcy6b)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    560807 (adcy6b)
   04270 Vascular smooth muscle contraction
    560807 (adcy6b)
Enzymes [BR:dre01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     560807 (adcy6b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA
Motif
Other DBs
NCBI-GeneID: 560807
NCBI-ProteinID: XP_002666536
ZFIN: ZDB-GENE-090127-2
Ensembl: ENSDARG00000027797
Vega: OTTDARG00000030526
UniProt: F1R9C3
Position
23
AA seq 1174 aa AA seqDB search
MSWVNGFKAARVDNHKTAWGERNGRKSRRKRGSSLCNPRYMSCLRDPESMEAPSQQYSRA
AGGATSSNFSTRCVWQEDHYGRKGDVGLRAVDLAFEDAETRQTKNGDDPDEGGVERKGPD
RCFFTCLLRLAHIFQSKKFKSAKLERLYQRYFFRLNQSSLTMLMGVLVVVCGVMLAFHCV
QGPPDVAYASVLSVAMGLFLTLMVVCNRNGFHQDYMWIVSYLVMGVLVVVQVFGLLMVDP
PSMPEGIWWTVFFIYIIYTLLPVRMRAAVITGAVLSTIHIVMAWRFNLEDSFLYKQLCAN
AMIFLCTNIIGICTHYPAEVSQRQAFKETRGYIQARIHLQRENQQQERLLLSVLPRHVAM
EMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFD
KLAWENHCLRIKILGDCYYCVSGLPEPRADHAHCCVEMGVDMIEAISLVREVTGVNVNMR
VGIHSGRVHCGVLGLRKWQFDVWSNDVTLANQMEAGGKAGRIHITKATLQYLNGDYEVEA
GFGGDRNAYLNNNNIETFFVLGCSQKRKEEKAMMAKMQRARANSSEGLMPRWVPDRSFSR
TKDSKVFRQMGIDEASSKDNRCAQEALNPEDEVDEFLGRAIDARSIDQLRKDHVKKFLLT
FQTPLLEKKYSKKVDDRFGGYVACTLLVFCFIVFIQIVIFPHTPLMLGLFITIFIILAHV
LFICAIYSCVKLFPVTLQTVSKRIVQSRINSTLVGVFTILLLFISAFVNMFTCDRTDMLA
CVAGHLNISESVTLCLLYNLSGLAEDPFFLCLDQPSACPLPEYFTYSVLLTLLCCSVFLH
ISSIGKLVLMLFIQICFLLLIEWPLVSLLDNADLLDTVDALYAFNETNYCQETVTKVSLR
VSIPVILTVFVLALYLHAQQVESTARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKD
VAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYTELEANNEGVECLRLLNEIIADF
DEIISEEKYKQLEKIKTIGSTYMAASGLNDSTYDKEGRTHILALADYAMRLREQMKYINE
HSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDLYHV
LESKGYQLECRGLVKVKGKGDMTTYFLNSGPVCS
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggtcaatggctttaaagctgcaagagtggacaaccacaagacagcatggggt
gaacgcaacggtcgaaaatcaaggcgtaaaaggggctcctccttgtgcaacccacgctac
atgagctgtctacgggaccccgagtccatggaagccccatcacaacagtactcccgtgca
gcagggggcgccaccagcagcaacttcagcacacgctgcgtttggcaggaagaccattac
ggcaggaagggcgatgttggtctgagagccgtggatttggcctttgaagatgctgagaca
aggcaaacaaaaaacggggacgaccctgatgaaggcggggtggagaggaagggtcctgac
aggtgttttttcacttgcttattgcgtctggcacacatttttcagtccaaaaagttcaag
tcagccaaactggagcgactgtatcagcggtacttcttcagactcaatcagagctctctc
acaatgctgatgggggttttagttgtggtttgtggggtcatgctggcgtttcactgtgtc
cagggtcccccagatgtggcgtacgcttcagtgctttctgtagccatgggcctgtttttg
actttgatggtggtgtgcaacagaaatggctttcatcaggactacatgtggattgtgagc
tacttggtgatgggggtgctggtggtggtgcaggtgtttggcctgttgatggtggatcca
cccagcatgcctgaagggatctggtggaccgttttcttcatctacatcatttacacgctg
ctgcccgtgcgaatgagggccgctgtgatcactggagctgtgctgtccaccattcacatc
gttatggcatggagattcaaccttgaggacagcttcctttacaaacagttatgtgccaat
gcgatgattttcctgtgcaccaacatcattggcatctgcacgcattacccagcagaggtg
tctcagagacaggccttcaaggagacccgaggatacatccaggccagaatccaccttcag
agagagaaccagcagcaggagcgcctgctgctctctgtgttgccaaggcatgttgccatg
gaaatgaaggccgacatcaacgccaagaaagaggatatgatgttccacaagatctacatc
cagaaacacgacaatgtcagtatcctgtttgcggacattgagggcttcacaagtttggcg
tctcagtgcaccgctcaggagctggtgatgacccttaatgagcttttcgctcgcttcgat
aaattggcttgggaaaaccactgtctgcggatcaagatcctgggggactgttattactgt
gtgtctgggcttccggagccgagggccgatcacgcgcactgctgtgtggagatgggagtg
gacatgatcgaggccatctcgttggttcgagaggtgaccggggtgaacgtgaacatgcgt
gtggggattcacagtggtcgtgtgcactgcggcgtcctcggcctacgcaaatggcagttt
gatgtctggtccaacgacgtcactctagcaaaccagatggaggcgggaggcaaagcaggg
cggatccacatcaccaaagccacactgcagtatttaaatggtgactatgaagtggaagca
ggttttggaggggacagaaacgcatacttgaataacaacaacatcgagacgttttttgta
ctgggctgcagtcagaaaaggaaagaggaaaaggctatgatggctaagatgcagcgcgcc
agagccaactcttcagagggtctgatgcctcggtgggttcctgacagatctttctccagg
actaaagactccaaagtcttcaggcagatgggcatagatgaagcctccagcaaagataac
cgctgtgcccaagaggctctgaatcctgaggacgaggtcgacgagtttttaggtcgtgcc
atcgacgctcgcagcatcgaccagctgcgaaaagaccacgtcaagaagttcctactcaca
ttccagacacctttactggagaaaaagtattccaaaaaggtggatgatcgttttggaggt
tatgtggcctgtaccctcctcgtcttctgcttcatagtttttatacaaatcgtcatattt
ccgcatacaccattaatgctgggcttgttcatcaccatctttattattctcgcccatgtg
ctctttatatgtgccatttactcctgcgttaagctcttcccagttaccttgcagacagtg
tcaaaaaggattgttcagtctcgtattaacagcacgctggtcggagtcttcacaattctg
cttctcttcatctctgccttcgttaatatgtttacctgtgaccggaccgatatgctagca
tgtgtggccggacatctgaatatctctgaatccgtcacactgtgcctgctgtataacctg
agcggactggcagaggatcctttcttcctgtgtctcgatcagccttcagcctgtccttta
cccgagtatttcacatacagtgtgctgctgactctgctgtgctgctccgtgttcctgcac
atcagcagtataggcaagctggtgctcatgctcttcatccagatctgcttcctgctgcta
atcgagtggcctctagtcagtctgctggacaacgctgacctgctggacaccgtcgatgca
ctgtacgctttcaacgaaacaaattattgtcaggaaacggtgactaaagtgtctctgagg
gtgtcgattcctgtcatcctcactgtatttgtcctggctctctatctgcatgcacagcag
gtcgaatccaccgcacgcctcgacttcctctggaaacttcaggccactgaagaaaaagag
gagatggaagagctgcaggcctacaaccgtcgtcttcttcacaacatcctgcccaaagat
gtggctgctcacttcctcgccagagagcgccgaaacgatgagctttactatcaatcctgc
gaatgtgtggctgttatgtttgcgtccatcagcaacttctctgagttttacactgagctc
gaagccaacaatgagggtgttgaatgcctgagactgctaaatgagatcatcgctgacttc
gatgagatcatctctgaagagaaatacaagcagctagagaagatcaaaactattggtagt
acttacatggccgcatctggattgaacgattcaacgtacgacaaagagggccgaacacac
attctggctctggctgactatgccatgaggctgcgagaacagatgaagtacatcaatgaa
cactcattcaacaactttcaaatgaaaataggtttgaacattgggccagtggttgctggt
gtgattggagccagaaagcctcagtatgacatatggggtaacacggtgaatgtggccagt
cgcatggacagcacaggtgttcctgatcgtatccaggtgaccacagatttgtaccatgtc
ctagaaagtaagggctaccagctggaatgtcgtggactggtaaaagtgaaggggaaagga
gatatgaccacttacttcctcaacagtggtcctgtctgcagttaa

DBGET integrated database retrieval system