KEGG   Danio rerio (zebrafish): 560807Help
Entry
560807            CDS       T01004                                 

Gene name
adcy6b, si:ch211-190a18.1
Definition
adenylate cyclase 6b
Orthology
K08046  
adenylate cyclase 6 [EC:4.6.1.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Purine metabolism
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dre00230]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:dre04114]
Cellular Processes; Cell communication; Gap junction [PATH:dre04540]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:dre04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:dre04914]
Organismal Systems; Endocrine system; Melanogenesis [PATH:dre04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:dre04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:dre04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
23
AA seq 1174 aa AA seqDB search
MSWVNGFKAARVDNHKTAWGERNGRKSRRKRGSSLCNPRYMSCLRDPESMEAPSQQYSRA
AGGATSSNFSTRCVWQEDHYGRKGDVGLRAVDLAFEDAETRQTKNGDDPDEGGVERKGPD
RCFFTCLLRLAHIFQSKKFKSAKLERLYQRYFFRLNQSSLTMLMGVLVVVCGVMLAFHCV
QGPPDVAYASVLSVAMGLFLTLMVVCNRNGFHQDYMWIVSYLVMGVLVVVQVFGLLMVDP
PSMPEGIWWTVFFIYIIYTLLPVRMRAAVITGAVLSTIHIVMAWRFNLEDSFLYKQLCAN
AMIFLCTNIIGICTHYPAEVSQRQAFKETRGYIQARIHLQRENQQQERLLLSVLPRHVAM
EMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFD
KLAWENHCLRIKILGDCYYCVSGLPEPRADHAHCCVEMGVDMIEAISLVREVTGVNVNMR
VGIHSGRVHCGVLGLRKWQFDVWSNDVTLANQMEAGGKAGRIHITKATLQYLNGDYEVEA
GFGGDRNAYLNNNNIETFFVLGCSQKRKEEKAMMAKMQRARANSSEGLMPRWVPDRSFSR
TKDSKVFRQMGIDEASSKDNRCAQEALNPEDEVDEFLGRAIDARSIDQLRKDHVKKFLLT
FQTPLLEKKYSKKVDDRFGGYVACTLLVFCFIVFIQIVIFPHTPLMLGLFITIFIILAHV
LFICAIYSCVKLFPVTLQTVSKRIVQSRINSTLVGVFTILLLFISAFVNMFTCDRTDMLA
CVAGHLNISESVTLCLLYNLSGLAEDPFFLCLDQPSACPLPEYFTYSVLLTLLCCSVFLH
ISSIGKLVLMLFIQICFLLLIEWPLVSLLDNADLLDTVDALYAFNETNYCQETVTKVSLR
VSIPVILTVFVLALYLHAQQVESTARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKD
VAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYTELEANNEGVECLRLLNEIIADF
DEIISEEKYKQLEKIKTIGSTYMAASGLNDSTYDKEGRTHILALADYAMRLREQMKYINE
HSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDLYHV
LESKGYQLECRGLVKVKGKGDMTTYFLNSGPVCS
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggtcaatggctttaaagctgcaagagtggacaaccacaagacagcatggggt
gaacgcaacggtcgaaaatcaaggcgtaaaaggggctcctccttgtgcaacccacgctac
atgagctgtctacgggaccccgagtccatggaagccccatcacaacagtactcccgtgca
gcagggggcgccaccagcagcaacttcagcacacgctgcgtttggcaggaagaccattac
ggcaggaagggcgatgttggtctgagagccgtggatttggcctttgaagatgctgagaca
aggcaaacaaaaaacggggacgaccctgatgaaggcggggtggagaggaagggtcctgac
aggtgttttttcacttgcttattgcgtctggcacacatttttcagtccaaaaagttcaag
tcagccaaactggagcgactgtatcagcggtacttcttcagactcaatcagagctctctc
acaatgctgatgggggttttagttgtggtttgtggggtcatgctggcgtttcactgtgtc
cagggtcccccagatgtggcgtacgcttcagtgctttctgtagccatgggcctgtttttg
actttgatggtggtgtgcaacagaaatggctttcatcaggactacatgtggattgtgagc
tacttggtgatgggggtgctggtggtggtgcaggtgtttggcctgttgatggtggatcca
cccagcatgcctgaagggatctggtggaccgttttcttcatctacatcatttacacgctg
ctgcccgtgcgaatgagggccgctgtgatcactggagctgtgctgtccaccattcacatc
gttatggcatggagattcaaccttgaggacagcttcctttacaaacagttatgtgccaat
gcgatgattttcctgtgcaccaacatcattggcatctgcacgcattacccagcagaggtg
tctcagagacaggccttcaaggagacccgaggatacatccaggccagaatccaccttcag
agagagaaccagcagcaggagcgcctgctgctctctgtgttgccaaggcatgttgccatg
gaaatgaaggccgacatcaacgccaagaaagaggatatgatgttccacaagatctacatc
cagaaacacgacaatgtcagtatcctgtttgcggacattgagggcttcacaagtttggcg
tctcagtgcaccgctcaggagctggtgatgacccttaatgagcttttcgctcgcttcgat
aaattggcttgggaaaaccactgtctgcggatcaagatcctgggggactgttattactgt
gtgtctgggcttccggagccgagggccgatcacgcgcactgctgtgtggagatgggagtg
gacatgatcgaggccatctcgttggttcgagaggtgaccggggtgaacgtgaacatgcgt
gtggggattcacagtggtcgtgtgcactgcggcgtcctcggcctacgcaaatggcagttt
gatgtctggtccaacgacgtcactctagcaaaccagatggaggcgggaggcaaagcaggg
cggatccacatcaccaaagccacactgcagtatttaaatggtgactatgaagtggaagca
ggttttggaggggacagaaacgcatacttgaataacaacaacatcgagacgttttttgta
ctgggctgcagtcagaaaaggaaagaggaaaaggctatgatggctaagatgcagcgcgcc
agagccaactcttcagagggtctgatgcctcggtgggttcctgacagatctttctccagg
actaaagactccaaagtcttcaggcagatgggcatagatgaagcctccagcaaagataac
cgctgtgcccaagaggctctgaatcctgaggacgaggtcgacgagtttttaggtcgtgcc
atcgacgctcgcagcatcgaccagctgcgaaaagaccacgtcaagaagttcctactcaca
ttccagacacctttactggagaaaaagtattccaaaaaggtggatgatcgttttggaggt
tatgtggcctgtaccctcctcgtcttctgcttcatagtttttatacaaatcgtcatattt
ccgcatacaccattaatgctgggcttgttcatcaccatctttattattctcgcccatgtg
ctctttatatgtgccatttactcctgcgttaagctcttcccagttaccttgcagacagtg
tcaaaaaggattgttcagtctcgtattaacagcacgctggtcggagtcttcacaattctg
cttctcttcatctctgccttcgttaatatgtttacctgtgaccggaccgatatgctagca
tgtgtggccggacatctgaatatctctgaatccgtcacactgtgcctgctgtataacctg
agcggactggcagaggatcctttcttcctgtgtctcgatcagccttcagcctgtccttta
cccgagtatttcacatacagtgtgctgctgactctgctgtgctgctccgtgttcctgcac
atcagcagtataggcaagctggtgctcatgctcttcatccagatctgcttcctgctgcta
atcgagtggcctctagtcagtctgctggacaacgctgacctgctggacaccgtcgatgca
ctgtacgctttcaacgaaacaaattattgtcaggaaacggtgactaaagtgtctctgagg
gtgtcgattcctgtcatcctcactgtatttgtcctggctctctatctgcatgcacagcag
gtcgaatccaccgcacgcctcgacttcctctggaaacttcaggccactgaagaaaaagag
gagatggaagagctgcaggcctacaaccgtcgtcttcttcacaacatcctgcccaaagat
gtggctgctcacttcctcgccagagagcgccgaaacgatgagctttactatcaatcctgc
gaatgtgtggctgttatgtttgcgtccatcagcaacttctctgagttttacactgagctc
gaagccaacaatgagggtgttgaatgcctgagactgctaaatgagatcatcgctgacttc
gatgagatcatctctgaagagaaatacaagcagctagagaagatcaaaactattggtagt
acttacatggccgcatctggattgaacgattcaacgtacgacaaagagggccgaacacac
attctggctctggctgactatgccatgaggctgcgagaacagatgaagtacatcaatgaa
cactcattcaacaactttcaaatgaaaataggtttgaacattgggccagtggttgctggt
gtgattggagccagaaagcctcagtatgacatatggggtaacacggtgaatgtggccagt
cgcatggacagcacaggtgttcctgatcgtatccaggtgaccacagatttgtaccatgtc
ctagaaagtaagggctaccagctggaatgtcgtggactggtaaaagtgaaggggaaagga
gatatgaccacttacttcctcaacagtggtcctgtctgcagttaa

DBGET integrated database retrieval system