KEGG   Danio rerio (zebrafish): 560807Help
Entry
560807            CDS       T01004                                 

Gene name
adcy6b, si:ch211-190a18.1
Definition
adenylate cyclase 6b
Orthology
K08046  
adenylate cyclase 6 [EC:4.6.1.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Purine metabolism
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    560807 (adcy6b)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    560807 (adcy6b)
  Cell communication
   04540 Gap junction
    560807 (adcy6b)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    560807 (adcy6b)
   04914 Progesterone-mediated oocyte maturation
    560807 (adcy6b)
   04916 Melanogenesis
    560807 (adcy6b)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    560807 (adcy6b)
   04270 Vascular smooth muscle contraction
    560807 (adcy6b)
Enzymes [BR:dre01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     560807 (adcy6b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
23
AA seq 1174 aa AA seqDB search
MSWVNGFKAARVDNHKTAWGERNGRKSRRKRGSSLCNPRYMSCLRDPESMEAPSQQYSRA
AGGATSSNFSTRCVWQEDHYGRKGDVGLRAVDLAFEDAETRQTKNGDDPDEGGVERKGPD
RCFFTCLLRLAHIFQSKKFKSAKLERLYQRYFFRLNQSSLTMLMGVLVVVCGVMLAFHCV
QGPPDVAYASVLSVAMGLFLTLMVVCNRNGFHQDYMWIVSYLVMGVLVVVQVFGLLMVDP
PSMPEGIWWTVFFIYIIYTLLPVRMRAAVITGAVLSTIHIVMAWRFNLEDSFLYKQLCAN
AMIFLCTNIIGICTHYPAEVSQRQAFKETRGYIQARIHLQRENQQQERLLLSVLPRHVAM
EMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFD
KLAWENHCLRIKILGDCYYCVSGLPEPRADHAHCCVEMGVDMIEAISLVREVTGVNVNMR
VGIHSGRVHCGVLGLRKWQFDVWSNDVTLANQMEAGGKAGRIHITKATLQYLNGDYEVEA
GFGGDRNAYLNNNNIETFFVLGCSQKRKEEKAMMAKMQRARANSSEGLMPRWVPDRSFSR
TKDSKVFRQMGIDEASSKDNRCAQEALNPEDEVDEFLGRAIDARSIDQLRKDHVKKFLLT
FQTPLLEKKYSKKVDDRFGGYVACTLLVFCFIVFIQIVIFPHTPLMLGLFITIFIILAHV
LFICAIYSCVKLFPVTLQTVSKRIVQSRINSTLVGVFTILLLFISAFVNMFTCDRTDMLA
CVAGHLNISESVTLCLLYNLSGLAEDPFFLCLDQPSACPLPEYFTYSVLLTLLCCSVFLH
ISSIGKLVLMLFIQICFLLLIEWPLVSLLDNADLLDTVDALYAFNETNYCQETVTKVSLR
VSIPVILTVFVLALYLHAQQVESTARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKD
VAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYTELEANNEGVECLRLLNEIIADF
DEIISEEKYKQLEKIKTIGSTYMAASGLNDSTYDKEGRTHILALADYAMRLREQMKYINE
HSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDLYHV
LESKGYQLECRGLVKVKGKGDMTTYFLNSGPVCS
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggtcaatggctttaaagctgcaagagtggacaaccacaagacagcatggggt
gaacgcaacggtcgaaaatcaaggcgtaaaaggggctcctccttgtgcaacccacgctac
atgagctgtctacgggaccccgagtccatggaagccccatcacaacagtactcccgtgca
gcagggggcgccaccagcagcaacttcagcacacgctgcgtttggcaggaagaccattac
ggcaggaagggcgatgttggtctgagagccgtggatttggcctttgaagatgctgagaca
aggcaaacaaaaaacggggacgaccctgatgaaggcggggtggagaggaagggtcctgac
aggtgttttttcacttgcttattgcgtctggcacacatttttcagtccaaaaagttcaag
tcagccaaactggagcgactgtatcagcggtacttcttcagactcaatcagagctctctc
acaatgctgatgggggttttagttgtggtttgtggggtcatgctggcgtttcactgtgtc
cagggtcccccagatgtggcgtacgcttcagtgctttctgtagccatgggcctgtttttg
actttgatggtggtgtgcaacagaaatggctttcatcaggactacatgtggattgtgagc
tacttggtgatgggggtgctggtggtggtgcaggtgtttggcctgttgatggtggatcca
cccagcatgcctgaagggatctggtggaccgttttcttcatctacatcatttacacgctg
ctgcccgtgcgaatgagggccgctgtgatcactggagctgtgctgtccaccattcacatc
gttatggcatggagattcaaccttgaggacagcttcctttacaaacagttatgtgccaat
gcgatgattttcctgtgcaccaacatcattggcatctgcacgcattacccagcagaggtg
tctcagagacaggccttcaaggagacccgaggatacatccaggccagaatccaccttcag
agagagaaccagcagcaggagcgcctgctgctctctgtgttgccaaggcatgttgccatg
gaaatgaaggccgacatcaacgccaagaaagaggatatgatgttccacaagatctacatc
cagaaacacgacaatgtcagtatcctgtttgcggacattgagggcttcacaagtttggcg
tctcagtgcaccgctcaggagctggtgatgacccttaatgagcttttcgctcgcttcgat
aaattggcttgggaaaaccactgtctgcggatcaagatcctgggggactgttattactgt
gtgtctgggcttccggagccgagggccgatcacgcgcactgctgtgtggagatgggagtg
gacatgatcgaggccatctcgttggttcgagaggtgaccggggtgaacgtgaacatgcgt
gtggggattcacagtggtcgtgtgcactgcggcgtcctcggcctacgcaaatggcagttt
gatgtctggtccaacgacgtcactctagcaaaccagatggaggcgggaggcaaagcaggg
cggatccacatcaccaaagccacactgcagtatttaaatggtgactatgaagtggaagca
ggttttggaggggacagaaacgcatacttgaataacaacaacatcgagacgttttttgta
ctgggctgcagtcagaaaaggaaagaggaaaaggctatgatggctaagatgcagcgcgcc
agagccaactcttcagagggtctgatgcctcggtgggttcctgacagatctttctccagg
actaaagactccaaagtcttcaggcagatgggcatagatgaagcctccagcaaagataac
cgctgtgcccaagaggctctgaatcctgaggacgaggtcgacgagtttttaggtcgtgcc
atcgacgctcgcagcatcgaccagctgcgaaaagaccacgtcaagaagttcctactcaca
ttccagacacctttactggagaaaaagtattccaaaaaggtggatgatcgttttggaggt
tatgtggcctgtaccctcctcgtcttctgcttcatagtttttatacaaatcgtcatattt
ccgcatacaccattaatgctgggcttgttcatcaccatctttattattctcgcccatgtg
ctctttatatgtgccatttactcctgcgttaagctcttcccagttaccttgcagacagtg
tcaaaaaggattgttcagtctcgtattaacagcacgctggtcggagtcttcacaattctg
cttctcttcatctctgccttcgttaatatgtttacctgtgaccggaccgatatgctagca
tgtgtggccggacatctgaatatctctgaatccgtcacactgtgcctgctgtataacctg
agcggactggcagaggatcctttcttcctgtgtctcgatcagccttcagcctgtccttta
cccgagtatttcacatacagtgtgctgctgactctgctgtgctgctccgtgttcctgcac
atcagcagtataggcaagctggtgctcatgctcttcatccagatctgcttcctgctgcta
atcgagtggcctctagtcagtctgctggacaacgctgacctgctggacaccgtcgatgca
ctgtacgctttcaacgaaacaaattattgtcaggaaacggtgactaaagtgtctctgagg
gtgtcgattcctgtcatcctcactgtatttgtcctggctctctatctgcatgcacagcag
gtcgaatccaccgcacgcctcgacttcctctggaaacttcaggccactgaagaaaaagag
gagatggaagagctgcaggcctacaaccgtcgtcttcttcacaacatcctgcccaaagat
gtggctgctcacttcctcgccagagagcgccgaaacgatgagctttactatcaatcctgc
gaatgtgtggctgttatgtttgcgtccatcagcaacttctctgagttttacactgagctc
gaagccaacaatgagggtgttgaatgcctgagactgctaaatgagatcatcgctgacttc
gatgagatcatctctgaagagaaatacaagcagctagagaagatcaaaactattggtagt
acttacatggccgcatctggattgaacgattcaacgtacgacaaagagggccgaacacac
attctggctctggctgactatgccatgaggctgcgagaacagatgaagtacatcaatgaa
cactcattcaacaactttcaaatgaaaataggtttgaacattgggccagtggttgctggt
gtgattggagccagaaagcctcagtatgacatatggggtaacacggtgaatgtggccagt
cgcatggacagcacaggtgttcctgatcgtatccaggtgaccacagatttgtaccatgtc
ctagaaagtaagggctaccagctggaatgtcgtggactggtaaaagtgaaggggaaagga
gatatgaccacttacttcctcaacagtggtcctgtctgcagttaa

DBGET integrated database retrieval system