KEGG   Danio rerio (zebrafish): 560807Help
Entry
560807            CDS       T01004                                 

Gene name
adcy6b, si:ch211-190a18.1
Definition
(RefSeq) adenylate cyclase 6b
  KO
K08046  
adenylate cyclase 6 [EC:4.6.1.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Purine metabolism
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    560807 (adcy6b)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    560807 (adcy6b)
  Cellular community - eukaryotes
   04540 Gap junction
    560807 (adcy6b)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    560807 (adcy6b)
   04914 Progesterone-mediated oocyte maturation
    560807 (adcy6b)
   04916 Melanogenesis
    560807 (adcy6b)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    560807 (adcy6b)
   04270 Vascular smooth muscle contraction
    560807 (adcy6b)
Enzymes [BR:dre01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     560807 (adcy6b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
23
AA seq 1174 aa AA seqDB search
MSWVNGFKAARVDNHKTAWGERNGRKSRRKRGSSLCNPRYMSCLRDPESMEAPSQQYSRA
AGGATSSNFSTRCVWQEDHYGRKGDVGLRAVDLAFEDAETRQTKNGDDPDEGGVERKGPD
RCFFTCLLRLAHIFQSKKFKSAKLERLYQRYFFRLNQSSLTMLMGVLVVVCGVMLAFHCV
QGPPDVAYASVLSVAMGLFLTLMVVCNRNGFHQDYMWIVSYLVMGVLVVVQVFGLLMVDP
PSMPEGIWWTVFFIYIIYTLLPVRMRAAVITGAVLSTIHIVMAWRFNLEDSFLYKQLCAN
AMIFLCTNIIGICTHYPAEVSQRQAFKETRGYIQARIHLQRENQQQERLLLSVLPRHVAM
EMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFD
KLAWENHCLRIKILGDCYYCVSGLPEPRADHAHCCVEMGVDMIEAISLVREVTGVNVNMR
VGIHSGRVHCGVLGLRKWQFDVWSNDVTLANQMEAGGKAGRIHITKATLQYLNGDYEVEA
GFGGDRNAYLNNNNIETFFVLGCSQKRKEEKAMMAKMQRARANSSEGLMPRWVPDRSFSR
TKDSKVFRQMGIDEASSKDNRCAQEALNPEDEVDEFLGRAIDARSIDQLRKDHVKKFLLT
FQTPLLEKKYSKKVDDRFGGYVACTLLVFCFIVFIQIVIFPHTPLMLGLFITIFIILAHV
LFICAIYSCVKLFPVTLQTVSKRIVQSRINSTLVGVFTILLLFISAFVNMFTCDRTDMLA
CVAGHLNISESVTLCLLYNLSGLAEDPFFLCLDQPSACPLPEYFTYSVLLTLLCCSVFLH
ISSIGKLVLMLFIQICFLLLIEWPLVSLLDNADLLDTVDALYAFNETNYCQETVTKVSLR
VSIPVILTVFVLALYLHAQQVESTARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKD
VAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYTELEANNEGVECLRLLNEIIADF
DEIISEEKYKQLEKIKTIGSTYMAASGLNDSTYDKEGRTHILALADYAMRLREQMKYINE
HSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDLYHV
LESKGYQLECRGLVKVKGKGDMTTYFLNSGPVCS
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggtcaatggctttaaagctgcaagagtggacaaccacaagacagcatggggt
gaacgcaacggtcgaaaatcaaggcgtaaaaggggctcctccttgtgcaacccacgctac
atgagctgtctacgggaccccgagtccatggaagccccatcacaacagtactcccgtgca
gcagggggcgccaccagcagcaacttcagcacacgctgcgtttggcaggaagaccattac
ggcaggaagggcgatgttggtctgagagccgtggatttggcctttgaagatgctgagaca
aggcaaacaaaaaacggggacgaccctgatgaaggcggggtggagaggaagggtcctgac
aggtgttttttcacttgcttattgcgtctggcacacatttttcagtccaaaaagttcaag
tcagccaaactggagcgactgtatcagcggtacttcttcagactcaatcagagctctctc
acaatgctgatgggggttttagttgtggtttgtggggtcatgctggcgtttcactgtgtc
cagggtcccccagatgtggcgtacgcttcagtgctttctgtagccatgggcctgtttttg
actttgatggtggtgtgcaacagaaatggctttcatcaggactacatgtggattgtgagc
tacttggtgatgggggtgctggtggtggtgcaggtgtttggcctgttgatggtggatcca
cccagcatgcctgaagggatctggtggaccgttttcttcatctacatcatttacacgctg
ctgcccgtgcgaatgagggccgctgtgatcactggagctgtgctgtccaccattcacatc
gttatggcatggagattcaaccttgaggacagcttcctttacaaacagttatgtgccaat
gcgatgattttcctgtgcaccaacatcattggcatctgcacgcattacccagcagaggtg
tctcagagacaggccttcaaggagacccgaggatacatccaggccagaatccaccttcag
agagagaaccagcagcaggagcgcctgctgctctctgtgttgccaaggcatgttgccatg
gaaatgaaggccgacatcaacgccaagaaagaggatatgatgttccacaagatctacatc
cagaaacacgacaatgtcagtatcctgtttgcggacattgagggcttcacaagtttggcg
tctcagtgcaccgctcaggagctggtgatgacccttaatgagcttttcgctcgcttcgat
aaattggcttgggaaaaccactgtctgcggatcaagatcctgggggactgttattactgt
gtgtctgggcttccggagccgagggccgatcacgcgcactgctgtgtggagatgggagtg
gacatgatcgaggccatctcgttggttcgagaggtgaccggggtgaacgtgaacatgcgt
gtggggattcacagtggtcgtgtgcactgcggcgtcctcggcctacgcaaatggcagttt
gatgtctggtccaacgacgtcactctagcaaaccagatggaggcgggaggcaaagcaggg
cggatccacatcaccaaagccacactgcagtatttaaatggtgactatgaagtggaagca
ggttttggaggggacagaaacgcatacttgaataacaacaacatcgagacgttttttgta
ctgggctgcagtcagaaaaggaaagaggaaaaggctatgatggctaagatgcagcgcgcc
agagccaactcttcagagggtctgatgcctcggtgggttcctgacagatctttctccagg
actaaagactccaaagtcttcaggcagatgggcatagatgaagcctccagcaaagataac
cgctgtgcccaagaggctctgaatcctgaggacgaggtcgacgagtttttaggtcgtgcc
atcgacgctcgcagcatcgaccagctgcgaaaagaccacgtcaagaagttcctactcaca
ttccagacacctttactggagaaaaagtattccaaaaaggtggatgatcgttttggaggt
tatgtggcctgtaccctcctcgtcttctgcttcatagtttttatacaaatcgtcatattt
ccgcatacaccattaatgctgggcttgttcatcaccatctttattattctcgcccatgtg
ctctttatatgtgccatttactcctgcgttaagctcttcccagttaccttgcagacagtg
tcaaaaaggattgttcagtctcgtattaacagcacgctggtcggagtcttcacaattctg
cttctcttcatctctgccttcgttaatatgtttacctgtgaccggaccgatatgctagca
tgtgtggccggacatctgaatatctctgaatccgtcacactgtgcctgctgtataacctg
agcggactggcagaggatcctttcttcctgtgtctcgatcagccttcagcctgtccttta
cccgagtatttcacatacagtgtgctgctgactctgctgtgctgctccgtgttcctgcac
atcagcagtataggcaagctggtgctcatgctcttcatccagatctgcttcctgctgcta
atcgagtggcctctagtcagtctgctggacaacgctgacctgctggacaccgtcgatgca
ctgtacgctttcaacgaaacaaattattgtcaggaaacggtgactaaagtgtctctgagg
gtgtcgattcctgtcatcctcactgtatttgtcctggctctctatctgcatgcacagcag
gtcgaatccaccgcacgcctcgacttcctctggaaacttcaggccactgaagaaaaagag
gagatggaagagctgcaggcctacaaccgtcgtcttcttcacaacatcctgcccaaagat
gtggctgctcacttcctcgccagagagcgccgaaacgatgagctttactatcaatcctgc
gaatgtgtggctgttatgtttgcgtccatcagcaacttctctgagttttacactgagctc
gaagccaacaatgagggtgttgaatgcctgagactgctaaatgagatcatcgctgacttc
gatgagatcatctctgaagagaaatacaagcagctagagaagatcaaaactattggtagt
acttacatggccgcatctggattgaacgattcaacgtacgacaaagagggccgaacacac
attctggctctggctgactatgccatgaggctgcgagaacagatgaagtacatcaatgaa
cactcattcaacaactttcaaatgaaaataggtttgaacattgggccagtggttgctggt
gtgattggagccagaaagcctcagtatgacatatggggtaacacggtgaatgtggccagt
cgcatggacagcacaggtgttcctgatcgtatccaggtgaccacagatttgtaccatgtc
ctagaaagtaagggctaccagctggaatgtcgtggactggtaaaagtgaaggggaaagga
gatatgaccacttacttcctcaacagtggtcctgtctgcagttaa

DBGET integrated database retrieval system