KEGG   Danio rerio (zebrafish): 560913Help
Entry
560913            CDS       T01004                                 

Gene name
map2k7, MKK7, si:ch211-254d18.2
Definition
mitogen-activated protein kinase kinase 7 (EC:2.7.12.2)
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Toll-like receptor signaling pathway
GnRH signaling pathway
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    560913 (map2k7)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    560913 (map2k7)
   04012 ErbB signaling pathway
    560913 (map2k7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    560913 (map2k7)
  Endocrine system
   04912 GnRH signaling pathway
    560913 (map2k7)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     560913 (map2k7)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   560913 (map2k7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
1
AA seq 438 aa AA seqDB search
MSSLEQRLSRIEEKLKQENKEARKRIDLNIDMSPQRTRPRPIIVIQLSPAPAPSQRAALQ
LPLANDGGSRSSSSESSPQHPSYPNRPRQMLTLPTTPYNLQKNLENAEIDQKLQEIMKQT
GYLKIDGQRYPAEVTDLISEGEIGSGTCGQVFKVRFKKTGHVIAVKQMRRTGNKDENKRI
LMDLDVVLKSHDCPYIIQCYGAIVTNTDVFIAMELMGTCAEKLKKRIQGPIPEAILGKMT
VAIVNALLYLKEKHGVIHRDVKPSNILLDAKGQIKLCDFGISGRLVDSKAKTRSAGCAAY
MAPERIDPPDPSKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPVL
PLSMGFSPDFQSFVKDCLTKDHRKRPKYHKLLEHSFIRRYEVSEVDVAGWFQAVMERTES
PRSSQCFSHHQLHSLFSR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgctggagcagagactctcccgaatcgaggagaaactcaagcaggaaaataaa
gaagctcgcaaacggatcgacctgaacatcgacatgagcccgcagcggacgcgcccgagg
ccaatcatcgtgatccagctcagtccagctccagccccttcccagcgcgcagctctacag
ttgcctttggccaacgatggaggcagtcgctcgtcctcgtcagaaagctcccctcaacac
ccctcgtaccccaatagaccccgacaaatgctcacacttcccacaacaccgtacaaccta
caaaagaacctggagaatgctgaaatcgatcagaagttgcaggaaatcatgaaacaaacc
ggatatttgaagattgatggacagcgttaccccgcagaggtgactgatctaatcagtgag
ggggagatcggcagtggaacctgtggacaggtgtttaaagttcgttttaagaagactggc
catgtcatcgcagtcaagcaaatgagaagaacgggtaacaaagatgagaataagagaatc
ctcatggatctggatgttgtattgaagagtcacgactgtccatacatcattcagtgctat
ggggcaatagtcaccaatacggatgtgttcattgccatggaactaatgggaacgtgtgca
gagaagctgaagaagaggatccaagggcccataccagaggccattctgggaaagatgacc
gtggctattgtgaatgctctgctttatctaaaagagaaacatggtgtcatacaccgagac
gtaaagccatctaatatcttgttggacgccaaagggcagatcaaactgtgtgattttggc
attagcggtcgattggtagattctaaggccaagactcgcagcgccggctgtgctgcgtac
atggcgcctgagagaatagaccctccagaccccagtaagccagattatgacatcagagcc
gacgtctggagtcttggcatttctctggtggagctagccacaggacagtttccttacaag
aactgcaagacagactttgaggttcttaccaaagttctgcaagaggacccgccagtgctt
cctctcagcatgggcttttcccctgactttcagtccttcgtcaaagactgcctcacaaag
gatcacagaaaaaggccaaaataccacaagctgcttgaacacagtttcatccgtcgttac
gaggtgtcagaagtggacgttgcgggctggtttcaggcggtgatggagcgcacagagtct
cctcgcagcagtcagtgcttcagccatcaccagctccactctctcttcagtaggtag

DBGET integrated database retrieval system