KEGG   Danio rerio (zebrafish): 560944Help
Entry
560944            CDS       T01004                                 

Gene name
pfkpa
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X7
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00010  Glycolysis / Gluconeogenesis
dre00030  Pentose phosphate pathway
dre00051  Fructose and mannose metabolism
dre00052  Galactose metabolism
dre01100  Metabolic pathways
dre01200  Carbon metabolism
dre01230  Biosynthesis of amino acids
dre03018  RNA degradation
Module
dre_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    560944 (pfkpa)
   00030 Pentose phosphate pathway
    560944 (pfkpa)
   00051 Fructose and mannose metabolism
    560944 (pfkpa)
   00052 Galactose metabolism
    560944 (pfkpa)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    560944 (pfkpa)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     560944 (pfkpa)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     560944 (pfkpa)
Messenger RNA biogenesis [BR:dre03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     560944 (pfkpa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 560944
NCBI-ProteinID: XP_002666643
ZFIN: ZDB-GENE-091112-22
Ensembl: ENSDARG00000028000
Vega: OTTDARG00000031740
Position
24
AA seq 787 aa AA seqDB search
MAQSDNKRFFENLTGAGKAIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFVHEGYQGM
VDGGDNIKEATWENVSSMLQVGGTVIGSARCKDFRTHEGRLKAAHNLIQRGITNLCVIGG
DGSLTGANLFREEWSGLLAELVQQGLIDEDAAQKYSALHIVGMVGSIDNDFCGTDMTIGT
DSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPEDG
WEEKMCQKLSAKRAGMKRLNIIIVAEGAIDRKNQPITSEHVKNLVVSRLGFDTRVTILGH
VQRGGTPSAFDRILASRMGVEAVLALLETTANTPACVVSLCGNQSVRLPLMECVQMTQEV
QKAMDGKRFEEAVQLRGRSFENNLKTYKLLAHRKPESELPHSNFNVAVLNVGAPAAGMNA
AVRSAVRVGISEGHKMFAVNDGFEGFYKGQIKEIKWADVGGWTGQGGSLLGTKRTLPAKH
IDKIAEQMRKYNINALLVIGGFEAYLGIMELLEARRTYEELCVPMVMVPATVSNNVPGSD
LSIGADTALNAITATCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADAAYIFE
EPFDIRDLQANVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYTEEGKGVFDCRKN
VLGHMQQGGAPSPFDRNFGTKISAKAMQWITKKLNESYRRGRVFANTEDSACLLGMRRRA
MVFQPVVQLKDETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVVVNRPKA
SETTVTI
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatcggacaataagaggttttttgagaacctgacaggcgctgggaaagccatc
gcggtgctgacaagcggaggagatgcgcaaggaatgaacgctgctgttcgggctgttgtc
cgtatgggaatttatgtaggagccaaagtctacttcgttcacgagggttatcagggtatg
gtggatggaggcgacaacataaaagaggcgacttgggagaatgtgtccagcatgctgcaa
gtgggtggcacagttattgggagcgcacgatgcaaagatttccgcactcatgagggtcgc
ctgaaggctgctcataatctcatacagagaggcatcaccaacttgtgtgttattggtgga
gacggcagcttgaccggggccaatctcttcagagaagagtggagcggcctgctggcagag
ctggtccagcaaggtctaattgatgaagacgcggctcagaagtactctgctcttcacatt
gtgggaatggtgggctccattgacaatgacttctgtggcacggacatgacgataggaaca
gactcagccttgcacagaatcattgaggtggtggatgcaatcatgacaacagctcagagt
caccagaggacattcgttctggaggtgatgggcaggcattgtggctatctggcattggtg
agtgccctggcatgtggagctgactgggtgttgattcccgaaatgccccctgaggatggc
tgggaagagaaaatgtgtcagaaactctccgcgaaacgcgcaggaatgaaaaggctgaat
atcattatagtagctgaaggtgcgattgatcgtaagaaccagcccattacctctgaacat
gtaaagaatctggtggtcagtcgtctgggcttcgacacgcgcgtgaccatcctgggccac
gtccagagaggaggaaccccttcagcatttgacaggattctggccagtcgtatgggtgtg
gaggcagttctggctctgcttgagaccacagcaaacacaccggcctgcgtggtgtcgcta
tgtgggaaccagtctgtgcggctgcccctcatggagtgtgtgcagatgacgcaagaagtg
cagaaggccatggatgggaaacggtttgaagaggccgtgcagctgcgtggccggagcttt
gagaacaacctgaagacgtacaagctgctggctcaccgcaaaccagagtccgagcttccg
catagtaattttaacgtggctgtgttgaatgtgggtgctccagcggcgggtatgaacgca
gccgttcgctctgctgtcagagttggcatctccgagggacataaaatgttcgctgtcaac
gacggctttgaaggattttataagggacagataaaagagattaagtgggctgatgtaggt
ggatggacaggccagggtggatccctgctgggaactaaacgaacgcttcctgcaaagcac
attgacaaaattgctgaacagatgcggaagtataacataaatgcacttttagtgatcgga
ggatttgaggcctacttggggatcatggagttgttagaagcccgcaggacttatgaggag
ttgtgtgtgccaatggtaatggtgccggccaccgtctccaacaatgtgcccggctcagac
ctcagcattggtgcagacacggctcttaacgctatcactgctacgtgtgaccgtattaag
cagtctgccagcggcacgaagcgccgtgtgtttatcatagagacgatggggggctactgt
gggtatctggccactgtcggtggtctggctgctggagcagatgctgcgtacatctttgag
gagccgtttgacatcagagacctacaggctaatgttgagcacttaacagagaaaatgaag
accagcattcagagaggactagttctgaggaacgagaacagcaatgaaaactacaccaca
gacttcatctatcagctctatactgaagaaggcaagggagtgtttgactgcaggaagaac
gttctgggtcacatgcagcagggtggcgctccttctccatttgaccgtaacttcgggacc
aaaatctctgcaaaggccatgcagtggatcaccaagaaactgaatgaaagctacagacgt
gggagagtgttcgctaacacagaagactcggcctgtttgctgggcatgcggcgtcgtgca
atggtcttccagcctgtggttcagctcaaagatgagactgactttgttcacagaatccca
aaggagcagtggtggctgaagttgcgtccactcatgaagatcctggccaagtataaaacc
agttacgacgtgtcagactctggacagctggagcacgtggtggtcaaccgacccaaagca
tccgaaaccaccgttaccatttaa

DBGET integrated database retrieval system