KEGG   Danio rerio (zebrafish): 560944Help
Entry
560944            CDS       T01004                                 

Gene name
pfkpa, si:ch73-73n3.1
Definition
phosphofructokinase, platelet a
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    560944 (pfkpa)
   01230 Biosynthesis of amino acids
    560944 (pfkpa)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    560944 (pfkpa)
   00030 Pentose phosphate pathway
    560944 (pfkpa)
   00051 Fructose and mannose metabolism
    560944 (pfkpa)
   00052 Galactose metabolism
    560944 (pfkpa)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    560944 (pfkpa)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     560944 (pfkpa)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     560944 (pfkpa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
24
AA seq 787 aa AA seqDB search
MAQSDNKRFFENLTGAGKAIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFVHEGYQGM
VDGGDNIKEATWENVSSMLQVGGTVIGSARCKDFRTHEGRLKAAHNLIQRGITNLCVIGG
DGSLTGANLFREEWSGLLAELVQQGLIDEDAAQKYSALHIVGMVGSIDNDFCGTDMTIGT
DSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPEDG
WEEKMCQKLSAKRAGMKRLNIIIVAEGAIDRKNQPITSEHVKNLVVSRLGFDTRVTILGH
VQRGGTPSAFDRILASRMGVEAVLALLETTANTPACVVSLCGNQSVRLPLMECVQMTQEV
QKAMDGKRFEEAVQLRGRSFENNLKTYKLLAHRKPESELPHSNFNVAVLNVGAPAAGMNA
AVRSAVRVGISEGHKMFAVNDGFEGFYKGQIKEIKWADVGGWTGQGGSLLGTKRTLPAKH
IDKIAEQMRKYNINALLVIGGFEAYLGIMELLEARRTYEELCVPMVMVPATVSNNVPGSD
LSIGADTALNAITATCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADAAYIFE
EPFDIRDLQANVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYTEEGKGVFDCRKN
VLGHMQQGGAPSPFDRNFGTKISAKAMQWITKKLNESYRRGRVFANTEDSACLLGMRRRA
MVFQPVVQLKDETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVVVNRPKA
SETTVTI
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatcggacaataagaggttttttgagaacctgacaggcgctgggaaagccatc
gcggtgctgacaagcggaggagatgcgcaaggaatgaacgctgctgttcgggctgttgtc
cgtatgggaatttatgtaggagccaaagtctacttcgttcacgagggttatcagggtatg
gtggatggaggcgacaacataaaagaggcgacttgggagaatgtgtccagcatgctgcaa
gtgggtggcacagttattgggagcgcacgatgcaaagatttccgcactcatgagggtcgc
ctgaaggctgctcataatctcatacagagaggcatcaccaacttgtgtgttattggtgga
gacggcagcttgaccggggccaatctcttcagagaagagtggagcggcctgctggcagag
ctggtccagcaaggtctaattgatgaagacgcggctcagaagtactctgctcttcacatt
gtgggaatggtgggctccattgacaatgacttctgtggcacggacatgacgataggaaca
gactcagccttgcacagaatcattgaggtggtggatgcaatcatgacaacagctcagagt
caccagaggacattcgttctggaggtgatgggcaggcattgtggctatctggcattggtg
agtgccctggcatgtggagctgactgggtgttgattcccgaaatgccccctgaggatggc
tgggaagagaaaatgtgtcagaaactctccgcgaaacgcgcaggaatgaaaaggctgaat
atcattatagtagctgaaggtgcgattgatcgtaagaaccagcccattacctctgaacat
gtaaagaatctggtggtcagtcgtctgggcttcgacacgcgcgtgaccatcctgggccac
gtccagagaggaggaaccccttcagcatttgacaggattctggccagtcgtatgggtgtg
gaggcagttctggctctgcttgagaccacagcaaacacaccggcctgcgtggtgtcgcta
tgtgggaaccagtctgtgcggctgcccctcatggagtgtgtgcagatgacgcaagaagtg
cagaaggccatggatgggaaacggtttgaagaggccgtgcagctgcgtggccggagcttt
gagaacaacctgaagacgtacaagctgctggctcaccgcaaaccagagtccgagcttccg
catagtaattttaacgtggctgtgttgaatgtgggtgctccagcggcgggtatgaacgca
gccgttcgctctgctgtcagagttggcatctccgagggacataaaatgttcgctgtcaac
gacggctttgaaggattttataagggacagataaaagagattaagtgggctgatgtaggt
ggatggacaggccagggtggatccctgctgggaactaaacgaacgcttcctgcaaagcac
attgacaaaattgctgaacagatgcggaagtataacataaatgcacttttagtgatcgga
ggatttgaggcctacttggggatcatggagttgttagaagcccgcaggacttatgaggag
ttgtgtgtgccaatggtaatggtgccggccaccgtctccaacaatgtgcccggctcagac
ctcagcattggtgcagacacggctcttaacgctatcactgctacgtgtgaccgtattaag
cagtctgccagcggcacgaagcgccgtgtgtttatcatagagacgatggggggctactgt
gggtatctggccactgtcggtggtctggctgctggagcagatgctgcgtacatctttgag
gagccgtttgacatcagagacctacaggctaatgttgagcacttaacagagaaaatgaag
accagcattcagagaggactagttctgaggaacgagaacagcaatgaaaactacaccaca
gacttcatctatcagctctatactgaagaaggcaagggagtgtttgactgcaggaagaac
gttctgggtcacatgcagcagggtggcgctccttctccatttgaccgtaacttcgggacc
aaaatctctgcaaaggccatgcagtggatcaccaagaaactgaatgaaagctacagacgt
gggagagtgttcgctaacacagaagactcggcctgtttgctgggcatgcggcgtcgtgca
atggtcttccagcctgtggttcagctcaaagatgagactgactttgttcacagaatccca
aaggagcagtggtggctgaagttgcgtccactcatgaagatcctggccaagtataaaacc
agttacgacgtgtcagactctggacagctggagcacgtggtggtcaaccgacccaaagca
tccgaaaccaccgttaccatttaa

DBGET integrated database retrieval system