KEGG   Danio rerio (zebrafish): 560944Help
Entry
560944            CDS       T01004                                 

Gene name
pfkpa, si:ch73-73n3.1
Definition
phosphofructokinase, platelet a
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:dre01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dre01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dre00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dre00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dre00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dre00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
24
AA seq 787 aa AA seqDB search
MAQSDNKRFFENLTGAGKAIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFVHEGYQGM
VDGGDNIKEATWENVSSMLQVGGTVIGSARCKDFRTHEGRLKAAHNLIQRGITNLCVIGG
DGSLTGANLFREEWSGLLAELVQQGLIDEDAAQKYSALHIVGMVGSIDNDFCGTDMTIGT
DSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPEDG
WEEKMCQKLSAKRAGMKRLNIIIVAEGAIDRKNQPITSEHVKNLVVSRLGFDTRVTILGH
VQRGGTPSAFDRILASRMGVEAVLALLETTANTPACVVSLCGNQSVRLPLMECVQMTQEV
QKAMDGKRFEEAVQLRGRSFENNLKTYKLLAHRKPESELPHSNFNVAVLNVGAPAAGMNA
AVRSAVRVGISEGHKMFAVNDGFEGFYKGQIKEIKWADVGGWTGQGGSLLGTKRTLPAKH
IDKIAEQMRKYNINALLVIGGFEAYLGIMELLEARRTYEELCVPMVMVPATVSNNVPGSD
LSIGADTALNAITATCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADAAYIFE
EPFDIRDLQANVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYTEEGKGVFDCRKN
VLGHMQQGGAPSPFDRNFGTKISAKAMQWITKKLNESYRRGRVFANTEDSACLLGMRRRA
MVFQPVVQLKDETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVVVNRPKA
SETTVTI
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatcggacaataagaggttttttgagaacctgacaggcgctgggaaagccatc
gcggtgctgacaagcggaggagatgcgcaaggaatgaacgctgctgttcgggctgttgtc
cgtatgggaatttatgtaggagccaaagtctacttcgttcacgagggttatcagggtatg
gtggatggaggcgacaacataaaagaggcgacttgggagaatgtgtccagcatgctgcaa
gtgggtggcacagttattgggagcgcacgatgcaaagatttccgcactcatgagggtcgc
ctgaaggctgctcataatctcatacagagaggcatcaccaacttgtgtgttattggtgga
gacggcagcttgaccggggccaatctcttcagagaagagtggagcggcctgctggcagag
ctggtccagcaaggtctaattgatgaagacgcggctcagaagtactctgctcttcacatt
gtgggaatggtgggctccattgacaatgacttctgtggcacggacatgacgataggaaca
gactcagccttgcacagaatcattgaggtggtggatgcaatcatgacaacagctcagagt
caccagaggacattcgttctggaggtgatgggcaggcattgtggctatctggcattggtg
agtgccctggcatgtggagctgactgggtgttgattcccgaaatgccccctgaggatggc
tgggaagagaaaatgtgtcagaaactctccgcgaaacgcgcaggaatgaaaaggctgaat
atcattatagtagctgaaggtgcgattgatcgtaagaaccagcccattacctctgaacat
gtaaagaatctggtggtcagtcgtctgggcttcgacacgcgcgtgaccatcctgggccac
gtccagagaggaggaaccccttcagcatttgacaggattctggccagtcgtatgggtgtg
gaggcagttctggctctgcttgagaccacagcaaacacaccggcctgcgtggtgtcgcta
tgtgggaaccagtctgtgcggctgcccctcatggagtgtgtgcagatgacgcaagaagtg
cagaaggccatggatgggaaacggtttgaagaggccgtgcagctgcgtggccggagcttt
gagaacaacctgaagacgtacaagctgctggctcaccgcaaaccagagtccgagcttccg
catagtaattttaacgtggctgtgttgaatgtgggtgctccagcggcgggtatgaacgca
gccgttcgctctgctgtcagagttggcatctccgagggacataaaatgttcgctgtcaac
gacggctttgaaggattttataagggacagataaaagagattaagtgggctgatgtaggt
ggatggacaggccagggtggatccctgctgggaactaaacgaacgcttcctgcaaagcac
attgacaaaattgctgaacagatgcggaagtataacataaatgcacttttagtgatcgga
ggatttgaggcctacttggggatcatggagttgttagaagcccgcaggacttatgaggag
ttgtgtgtgccaatggtaatggtgccggccaccgtctccaacaatgtgcccggctcagac
ctcagcattggtgcagacacggctcttaacgctatcactgctacgtgtgaccgtattaag
cagtctgccagcggcacgaagcgccgtgtgtttatcatagagacgatggggggctactgt
gggtatctggccactgtcggtggtctggctgctggagcagatgctgcgtacatctttgag
gagccgtttgacatcagagacctacaggctaatgttgagcacttaacagagaaaatgaag
accagcattcagagaggactagttctgaggaacgagaacagcaatgaaaactacaccaca
gacttcatctatcagctctatactgaagaaggcaagggagtgtttgactgcaggaagaac
gttctgggtcacatgcagcagggtggcgctccttctccatttgaccgtaacttcgggacc
aaaatctctgcaaaggccatgcagtggatcaccaagaaactgaatgaaagctacagacgt
gggagagtgttcgctaacacagaagactcggcctgtttgctgggcatgcggcgtcgtgca
atggtcttccagcctgtggttcagctcaaagatgagactgactttgttcacagaatccca
aaggagcagtggtggctgaagttgcgtccactcatgaagatcctggccaagtataaaacc
agttacgacgtgtcagactctggacagctggagcacgtggtggtcaaccgacccaaagca
tccgaaaccaccgttaccatttaa

DBGET integrated database retrieval system