KEGG   Danio rerio (zebrafish): 560986Help
Entry
560986            CDS       T01004                                 

Definition
novel protein similar to H.sapiens PNPLA6, patatin-like phospholipase domain containing 6 (PNPLA6)
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dre00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
1
AA seq 1342 aa AA seqDB search
MGQSTSDTESAEPPETDRFGNIKSLVEDQLQTSMVVGIVIGAGVVIVLIAVLIFFVLRRM
QLRKLEAQEVPKYRFRKRDKVLFYGRKIMRKVSQSTSSLVGATSSTRPRLKKKQKMLNIA
KKILRFKKEVPTLQMKEPPPSVLEADLTEFDVANSHLPSEVLYMLKNVRVLGHFEKPLFL
ELCKHMVFLQFQQGEYVFRPGQPDSSIYVVQDGKLELCLTGQDGKDGVVKEVYPGDSVHS
LLSILDVITGHQRPYKTVSARAAEVSTVLRLPVDAFLSIFEKYPESLVRVVQIIMVRLQR
VTVLALHNYLGLTNELFSHEMQPRSSPLSPHPTRSSPVRHSKRFGSLTVPDKHREAAVQN
ATGGDHGKEGGTIPTLSRTISMPVDIAGMQKSLRSDFDMAYERGRISVSAEDGVPAFTKE
QRERKVTVDEVPSGVYLYPEEESGMDIFSSFQGRPNATVFEEAQKEILRLMKIEDPSLLN
GRVTFHHAKAGSVLARQGDQDVSLHFVLSGCLHVYQKMIDKQEAVCLFVTQPGEMVGQLA
VLTGEPLIFTIKAERDCTFLKISKSEFYEIMREQPSVVLSAAHTVAIRMSAFVRQMDFAI
DWMAVEAGRALYRQDDQSDCTYIVLNGRLRSVIRKANGKKELVGEYGRGDLIGVVEALTR
QPRATTVHAVRDTELVKLPEGTLNNIKRRYPQVVTRLIHLLGQKILGNLQQPRGPFSSSA
LGLPSMASSPDVTNPASNLSTVAVLPVCDEVPINAFNLELSHALSAIGPTLLLTSDIIRE
RLGASALDSIHEYRLSGWLAQQEDINRIVLYQTDSGMTPWTQRCIRQADCILIVGLGDQE
PALGELEQMLENTAVRALKQLILLHREDGPGPSRTVEWLNMRSWCSGHLHLKCPRRVFSR
RSPTKLREVYEKVFEKTADRHSDFSRLARVLTGNSIALVLGGGGARGCSHVGVIKAMEDT
GIPIDIVGGTSIGSFIGALYAEERSAVRVKQRAREWSKAMNSVFKTVLDLTYPITSMFSG
SAFNTSISKVFEDKQIEDLWLPYFNVTTDITASAMRVHKDGSLWRYVRASMTLSGYLPPL
CDPKDGNLLMDGGYINNLPADIARTLGTKTVIAIDVGSQDETDLCNYGDCLSGWWLLWKR
INPWAEKVKVPDMAEIQSRLAYVSCVRQLELVKKSAYCEYIRPPIDRFKTMDFGKFDEIY
DVGYQHGKLVFTEWARGDIIDNMLKDHRSADYNDSKKTDSCPCPSADFTDLAEIVSRIEP
VQSYVGADEESDYATEYEEDGMDTVREEEGEEEEEEGEDPEDQSPGEWGPNGVFPPDEDK
TVRQRKNVSRDPNADFSGVSDC
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atgggacagagcacatcggacacagagtccgcagaacctccagagacggacagatttgga
aacatcaagagtttagtggaggatcagctgcagaccagcatggtggtggggattgtaatc
ggcgctggagtcgtcatcgttctcatcgccgtcctcatattttttgtcttgcgccggatg
cagctccgcaaactggaggctcaggaagtcccaaagtatcgatttcgtaaaagagacaaa
gtgttgttttatgggaggaagatcatgaggaaagtatctcaatccacctcttccttggtg
ggtgccacttcctccaccagaccccgtctcaaaaagaagcagaagatgctgaacattgcc
aaaaagatcctgcgctttaagaaggaagtgcccactttgcagatgaaggaacctcctccg
tcagtgctggaagcagatctcaccgaatttgatgtcgctaattcccatctaccctccgag
gtgctctacatgctcaagaacgtgcgtgtgttgggacactttgagaagccgttgtttctg
gagctgtgcaagcacatggtgtttctgcagttccagcagggtgaatatgtcttcaggcct
ggtcagcctgatagcagcatatatgtagtacaggatggcaagctggagttgtgtcttact
ggacaggatgggaaggatggggtggttaaagaggtttaccctggagacagtgttcacagt
ctactaagcatccttgatgtcatcacaggtcaccagagaccttacaaaacggtctcggca
agagcagcagaagtgtccactgtcctcagactgcctgtggatgcctttctgtccattttt
gagaaatacccagagagtcttgtgcgagttgttcagatcatcatggtgcgtcttcagaga
gtgactgttctggctctgcacaactacctggggctcaccaatgaactcttcagccacgaa
atgcagcctcgttcctctcccctctctcctcatccgactcgctccagtcctgtacgacac
agcaaacgcttcggcagtctgactgttcctgacaaacaccgtgaggcggctgtccaaaat
gctactggtggggatcatgggaaggagggtggcacaattccgacccttagtagaaccata
tcaatgcctgtagacattgctggaatgcagaagagtctgcgttcagatttcgacatggcg
tatgaaagaggtcgtatctctgtatctgcagaggatggagtgcctgctttcacaaaggag
cagcgggagaggaaagtgaccgtggatgaggttccttcaggtgtgtatttgtatcctgag
gaggaatcagggatggacatttttagctcatttcaaggacgaccaaacgctacagtgttc
gaggaggcccagaaggagatcctcagactcatgaagatcgaggacccttcgctactcaac
gggagggtgacgtttcatcatgccaaagctggatctgtgttagccagacagggagaccag
gacgtgagtctgcatttcgtcctctccggctgtctgcacgtctaccagaagatgatcgac
aagcaggaagccgtgtgtttgtttgtgacccagccgggggagatggtgggtcagctggct
gtgcttacaggagagccgcttatcttcaccatcaaagcggagcgagactgcaccttcctc
aagatctccaaatccgaattctatgagatcatgcgtgaacagccaagtgtagttcttagc
gcagctcacactgtagctattcgcatgtcagcgtttgtgcgacagatggatttcgccatt
gactggatggctgttgaagctggacgagccttgtaccggcaagatgaccagtctgattgc
acctatattgtgctaaatggacgattgcgttctgtcattcgaaaagcgaatggtaagaag
gagctggttggagagtatgggcgaggagatctcataggcgtggtggaggctttgacgcgg
cagcctcgtgccaccacagtccatgcggtcagagacactgagctggtgaagcttccagag
ggaacactcaacaatattaagagaagatacccacaggtggtgacgcggttgatccatctg
ctgggacagaagattttgggaaacctccaacagccccgtggacctttctcaagctctgct
ctgggtctgccaagcatggcgtccagtccagacgtcactaacccagccagtaatctctca
actgtggccgtgcttccagtttgtgatgaggtgccaatcaatgccttcaatttggaactt
agccatgccctcagcgccataggaccaaccctgttgctaaccagtgacatcatcagagaa
agactaggggcttctgctttggacagtattcacgagtacaggttatcaggttggttggct
cagcaggaggacattaatcgtatagtgctgtatcagacggacagtggaatgaccccatgg
actcaacgctgcatccgacaagcggactgcatcctcattgtagggctcggtgaccaggaa
cctgcacttggagagttggagcagatgttggagaacacagcagtgcgggctctgaaacag
cttattttgctgcaccgtgaggatggtccgggcccgtcaagaacagtcgaatggctgaac
atgcgaagctggtgctctggacaccttcacctgaagtgtcctcgtagagtcttctcacga
agaagccctaccaaactgagagaggtatatgaaaaagtgtttgagaagactgcagacaga
cacagcgatttctcacggctggccagagtactcacaggaaacagcattgcccttgtgctc
ggaggaggcggagccaggggttgctctcatgttggtgtaatcaaagccatggaggataca
ggaattcccatcgatatagtgggaggaacctccattggctcattcattggtgctctgtat
gcagaggagagaagtgcagttcgggtcaagcagagagcaagagagtggtccaaggctatg
aactcggtgttcaaaacagttctggatcttacttatccaatcacgtccatgttctcgggc
tctgccttcaacaccagcatctccaaagtctttgaggacaaacaaattgaggacttgtgg
ctgccttacttcaacgtgaccacagatatcacagcttctgctatgcgtgttcataaagat
ggctccctgtggcgctatgtcagggcgagcatgaccctttccgggtacctgccacccctc
tgcgaccctaaagatggaaacctgctcatggatggaggatacatcaacaacctgccagcg
gacattgctcgtactttgggcacaaaaactgtcattgccattgatgtgggcagccaggat
gagactgatctctgtaactacggtgactgtctttctggctggtggctgctatggaaacga
atcaacccgtgggcagagaaagtgaaggtacctgacatggctgaaatccagtctcgtttg
gcctacgtgtcctgtgtaaggcagctggaactagtcaagaagagtgcatactgcgagtac
attcgcccacccatcgaccgctttaagaccatggattttgggaaatttgatgaaatctat
gatgtgggttatcaacatggcaaactggtgtttaccgagtgggctcgtggggacattatt
gacaatatgctaaaagatcatcgatcggctgactataatgacagcaagaagacggactca
tgtccgtgtcctagtgcagacttcactgatctagctgaaattgtgtccaggattgagcct
gtgcagagctatgtaggagccgatgaggagtctgactatgcgacagaatacgaggaagac
gggatggacacagtgagagaagaagaaggtgaggaagaggaggaggagggtgaagaccct
gaggatcagtctcctggagaatggggaccaaatggggtcttcccaccagatgaagataag
acagtccgtcagaggaagaatgtttccagggaccccaacgctgacttttctggagtgtca
gattgttga

DBGET integrated database retrieval system