KEGG   Danio rerio (zebrafish): 560986Help
Entry
560986            CDS       T01004                                 

Gene name
pnpla6
Definition
patatin-like phospholipase domain containing 6
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    560986 (pnpla6)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     560986 (pnpla6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
1
AA seq 1342 aa AA seqDB search
MGQSTSDTESAEPPETDRFGNIKSLVEDQLQTSMVVGIVIGAGVVIVLIAVLIFFVLRRM
QLRKLEAQEVPKYRFRKRDKVLFYGRKIMRKVSQSTSSLVGATSSTRPRLKKKQKMLNIA
KKILRFKKEVPTLQMKEPPPSVLEADLTEFDVANSHLPSEVLYMLKNVRVLGHFEKPLFL
ELCKHMVFLQFQQGEYVFRPGQPDSSIYVVQDGKLELCLTGQDGKDGVVKEVYPGDSVHS
LLSILDVITGHQRPYKTVSARAAEVSTVLRLPVDAFLSIFEKYPESLVRVVQIIMVRLQR
VTVLALHNYLGLTNELFSHEMQPRSSPLSPHPTRSSPVRHSKRFGSLTVPDKHREAAVQN
ATGGDHGKEGGTIPTLSRTISMPVDIAGMQKSLRSDFDMAYERGRISVSAEDGVPAFTKE
QRERKVTVDEVPSGVYLYPEEESGMDIFSSFQGRPNATVFEEAQKEILRLMKIEDPSLLN
GRVTFHHAKAGSVLARQGDQDVSLHFVLSGCLHVYQKMIDKQEAVCLFVTQPGEMVGQLA
VLTGEPLIFTIKAERDCTFLKISKSEFYEIMREQPSVVLSAAHTVAIRMSAFVRQMDFAI
DWMAVEAGRALYRQDDQSDCTYIVLNGRLRSVIRKANGKKELVGEYGRGDLIGVVEALTR
QPRATTVHAVRDTELVKLPEGTLNNIKRRYPQVVTRLIHLLGQKILGNLQQPRGPFSSSA
LGLPSMASSPDVTNPASNLSTVAVLPVCDEVPINAFNLELSHALSAIGPTLLLTSDIIRE
RLGASALDSIHEYRLSGWLAQQEDINRIVLYQTDSGMTPWTQRCIRQADCILIVGLGDQE
PALGELEQMLENTAVRALKQLILLHREDGPGPSRTVEWLNMRSWCSGHLHLKCPRRVFSR
RSPTKLREVYEKVFEKTADRHSDFSRLARVLTGNSIALVLGGGGARGCSHVGVIKAMEDT
GIPIDIVGGTSIGSFIGALYAEERSAVRVKQRAREWSKAMNSVFKTVLDLTYPITSMFSG
SAFNTSISKVFEDKQIEDLWLPYFNVTTDITASAMRVHKDGSLWRYVRASMTLSGYLPPL
CDPKDGNLLMDGGYINNLPADIARTLGTKTVIAIDVGSQDETDLCNYGDCLSGWWLLWKR
INPWAEKVKVPDMAEIQSRLAYVSCVRQLELVKKSAYCEYIRPPIDRFKTMDFGKFDEIY
DVGYQHGKLVFTEWARGDIIDNMLKDHRSADYNDSKKTDSCPCPSADFTDLAEIVSRIEP
VQSYVGADEESDYATEYEEDGMDTVREEEGEEEEEEGEDPEDQSPGEWGPNGVFPPDEDK
TVRQRKNVSRDPNADFSGVSDC
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atgggacagagcacatcggacacagagtccgcagaacctccagagacggacagatttgga
aacatcaagagtttagtggaggatcagctgcagaccagcatggtggtggggattgtaatc
ggcgctggagtcgtcatcgttctcatcgccgtcctcatattttttgtcttgcgccggatg
cagctccgcaaactggaggctcaggaagtcccaaagtatcgatttcgtaaaagagacaaa
gtgttgttttatgggaggaagatcatgaggaaagtatctcaatccacctcttccttggtg
ggtgccacttcctccaccagaccccgtctcaaaaagaagcagaagatgctgaacattgcc
aaaaagatcctgcgctttaagaaggaagtgcccactttgcagatgaaggaacctcctccg
tcagtgctggaagcagatctcaccgaatttgatgtcgctaattcccatctaccctccgag
gtgctctacatgctcaagaacgtgcgtgtgttgggacactttgagaagccgttgtttctg
gagctgtgcaagcacatggtgtttctgcagttccagcagggtgaatatgtcttcaggcct
ggtcagcctgatagcagcatatatgtagtacaggatggcaagctggagttgtgtcttact
ggacaggatgggaaggatggggtggttaaagaggtttaccctggagacagtgttcacagt
ctactaagcatccttgatgtcatcacaggtcaccagagaccttacaaaacggtctcggca
agagcagcagaagtgtccactgtcctcagactgcctgtggatgcctttctgtccattttt
gagaaatacccagagagtcttgtgcgagttgttcagatcatcatggtgcgtcttcagaga
gtgactgttctggctctgcacaactacctggggctcaccaatgaactcttcagccacgaa
atgcagcctcgttcctctcccctctctcctcatccgactcgctccagtcctgtacgacac
agcaaacgcttcggcagtctgactgttcctgacaaacaccgtgaggcggctgtccaaaat
gctactggtggggatcatgggaaggagggtggcacaattccgacccttagtagaaccata
tcaatgcctgtagacattgctggaatgcagaagagtctgcgttcagatttcgacatggcg
tatgaaagaggtcgtatctctgtatctgcagaggatggagtgcctgctttcacaaaggag
cagcgggagaggaaagtgaccgtggatgaggttccttcaggtgtgtatttgtatcctgag
gaggaatcagggatggacatttttagctcatttcaaggacgaccaaacgctacagtgttc
gaggaggcccagaaggagatcctcagactcatgaagatcgaggacccttcgctactcaac
gggagggtgacgtttcatcatgccaaagctggatctgtgttagccagacagggagaccag
gacgtgagtctgcatttcgtcctctccggctgtctgcacgtctaccagaagatgatcgac
aagcaggaagccgtgtgtttgtttgtgacccagccgggggagatggtgggtcagctggct
gtgcttacaggagagccgcttatcttcaccatcaaagcggagcgagactgcaccttcctc
aagatctccaaatccgaattctatgagatcatgcgtgaacagccaagtgtagttcttagc
gcagctcacactgtagctattcgcatgtcagcgtttgtgcgacagatggatttcgccatt
gactggatggctgttgaagctggacgagccttgtaccggcaagatgaccagtctgattgc
acctatattgtgctaaatggacgattgcgttctgtcattcgaaaagcgaatggtaagaag
gagctggttggagagtatgggcgaggagatctcataggcgtggtggaggctttgacgcgg
cagcctcgtgccaccacagtccatgcggtcagagacactgagctggtgaagcttccagag
ggaacactcaacaatattaagagaagatacccacaggtggtgacgcggttgatccatctg
ctgggacagaagattttgggaaacctccaacagccccgtggacctttctcaagctctgct
ctgggtctgccaagcatggcgtccagtccagacgtcactaacccagccagtaatctctca
actgtggccgtgcttccagtttgtgatgaggtgccaatcaatgccttcaatttggaactt
agccatgccctcagcgccataggaccaaccctgttgctaaccagtgacatcatcagagaa
agactaggggcttctgctttggacagtattcacgagtacaggttatcaggttggttggct
cagcaggaggacattaatcgtatagtgctgtatcagacggacagtggaatgaccccatgg
actcaacgctgcatccgacaagcggactgcatcctcattgtagggctcggtgaccaggaa
cctgcacttggagagttggagcagatgttggagaacacagcagtgcgggctctgaaacag
cttattttgctgcaccgtgaggatggtccgggcccgtcaagaacagtcgaatggctgaac
atgcgaagctggtgctctggacaccttcacctgaagtgtcctcgtagagtcttctcacga
agaagccctaccaaactgagagaggtatatgaaaaagtgtttgagaagactgcagacaga
cacagcgatttctcacggctggccagagtactcacaggaaacagcattgcccttgtgctc
ggaggaggcggagccaggggttgctctcatgttggtgtaatcaaagccatggaggataca
ggaattcccatcgatatagtgggaggaacctccattggctcattcattggtgctctgtat
gcagaggagagaagtgcagttcgggtcaagcagagagcaagagagtggtccaaggctatg
aactcggtgttcaaaacagttctggatcttacttatccaatcacgtccatgttctcgggc
tctgccttcaacaccagcatctccaaagtctttgaggacaaacaaattgaggacttgtgg
ctgccttacttcaacgtgaccacagatatcacagcttctgctatgcgtgttcataaagat
ggctccctgtggcgctatgtcagggcgagcatgaccctttccgggtacctgccacccctc
tgcgaccctaaagatggaaacctgctcatggatggaggatacatcaacaacctgccagcg
gacattgctcgtactttgggcacaaaaactgtcattgccattgatgtgggcagccaggat
gagactgatctctgtaactacggtgactgtctttctggctggtggctgctatggaaacga
atcaacccgtgggcagagaaagtgaaggtacctgacatggctgaaatccagtctcgtttg
gcctacgtgtcctgtgtaaggcagctggaactagtcaagaagagtgcatactgcgagtac
attcgcccacccatcgaccgctttaagaccatggattttgggaaatttgatgaaatctat
gatgtgggttatcaacatggcaaactggtgtttaccgagtgggctcgtggggacattatt
gacaatatgctaaaagatcatcgatcggctgactataatgacagcaagaagacggactca
tgtccgtgtcctagtgcagacttcactgatctagctgaaattgtgtccaggattgagcct
gtgcagagctatgtaggagccgatgaggagtctgactatgcgacagaatacgaggaagac
gggatggacacagtgagagaagaagaaggtgaggaagaggaggaggagggtgaagaccct
gaggatcagtctcctggagaatggggaccaaatggggtcttcccaccagatgaagataag
acagtccgtcagaggaagaatgtttccagggaccccaacgctgacttttctggagtgtca
gattgttga

DBGET integrated database retrieval system