KEGG   Danio rerio (zebrafish): 561007Help
Entry
561007            CDS       T01004                                 

Gene name
pdk4, si:rp71-57j15.4
Definition
pyruvate dehydrogenase kinase, isozyme 4 (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
19
AA seq 409 aa AA seqDB search
MKFAQIMLKNSSKLNIPKQVDRFSKFSPSPLSMKQFIDFGSANACEKTSFMFLRQELPVR
LANIMKEIDFLPDKLLGTPSLKLLQSWYAQSLMELVDFLEKDPDDKKILTKFTETLINVR
NRHNNVVPTMAQGVLEYKEAFGVDPVTNQNVQYFLDRFYMSRISTRMLMNQHTLIFDGST
NPAHPKHIGSIDPNCDVVEVVRDAYESSKMLCDQYYLTSPEVEIKQVNIKGPSDPIHIVY
VPSHLYHMLFELFKNAMRATVETHETSLHLPPIKVRVSLGTEDLTIKMSDRGSGVPLRKI
ERLFSYMYSTAPSPVAEDTRNAPLAGFGYGLPISRLYAKYFQGDLQLYSMEGYGTSAVIY
LKALSTESIERLPVFNKSALRHYQTSTEADDWCIPSSEPKKLGKYEFSV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgcccagatcatgctgaagaacagctcgaagctgaacatacccaagcaagtg
gacagattttctaaattctccccgtcgccgctgtcaatgaagcagttcatagactttgga
tctgccaatgcgtgtgagaagacctccttcatgtttctgaggcaggagcttcccgtccgg
ctagcgaacatcatgaaggagatcgactttcttccggacaaactgctcggcactccttca
ctgaagctgctgcagagctggtacgctcagagtctaatggagctggtggactttttggag
aaagaccctgatgataaaaaaatcctgactaaattcacagaaacactgatcaatgtcagg
aacaggcataataatgtggtccccaccatggcacagggggtgctggagtacaaggaggcc
tttggcgtggatccagtgaccaatcagaacgtccagtattttctggaccgcttctacatg
agccgaatctccacacgcatgttgatgaatcagcacacgttaatctttgatggcagcacc
aatccagcccaccccaaacacattggcagtatcgacccaaactgtgacgttgtagaggtc
gtcagagatgcctatgaaagctccaagatgctgtgtgatcagtactacttgacctctcct
gaagtggaaatcaaacaagtgaacattaaaggacccagtgaccctatacatatagtttat
gtgccttctcatctctaccacatgctctttgagcttttcaagaatgcaatgagagcaact
gtggaaacccacgagaccagccttcatctcccaccaatcaaagtgagagtttctctagga
acagaagatctgactattaagatgtctgacagaggcagtggagttcctttgaggaaaatt
gaacgactttttagctacatgtattcaactgcgccgagtcctgtggctgaagacactcgc
aatgctcccctggctggttttggctatggtcttcctatctctcgtctctatgctaaatac
ttccagggagatctgcagctctactctatggagggatatggcacatctgcagtcatttat
ctaaaggccttatccactgaatcaatagagaggcttcctgtcttcaacaagtcagcctta
aggcactatcaaaccagcacagaagcggatgattggtgcatcccgagcagcgagcccaag
aaactaggaaagtatgagttcagcgtttga

DBGET integrated database retrieval system