KEGG   Danio rerio (zebrafish): 561322Help
Entry
561322            CDS       T01004                                 

Gene name
si:ch211-113a14.28
Definition
(RefSeq) histone H2B 1/2
  KO
K11252  histone H2B
Organism
dre  Danio rerio (zebrafish)
Brite
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    561322 (si:ch211-113a14.28)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   561322 (si:ch211-113a14.28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 561322
NCBI-ProteinID: XP_005163256
ZFIN: ZDB-GENE-121214-199
Ensembl: ENSDARG00000070297
Vega: OTTDARG00000039601
UniProt: Q5BJA5 A7MCA7
Position
25
AA seq 124 aa AA seqDB search
MPEPAKAAPKKGSKKAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccagcaaaagccgcacccaagaagggctccaagaaagcggtcactaagacc
gcaggaaaaggaggaaagaagcgcaagaggaccaggaaggaaagctacgctatctacgtc
tacaaagtgttgaagcaagttcacccagacaccgggatctcctccaaagcgatgggcatc
atgaactcgttcgtcaatgacatcttcgagcgcatcgccggtgaggcttctcgtctcgct
cactacaataagcgctccaccatcacttccagagagatccagaccgccgtgcgtctgctg
ctgcccggtgagctggccaaacacgccgtgtctgagggcaccaaggctgtgaccaaatac
accagctccaagtaa

DBGET integrated database retrieval system