KEGG   Danio rerio (zebrafish): 561322Help
Entry
561322            CDS       T01004                                 

Definition
si:ch211-113a14.28
Orthology
K11252  
histone H2B
Organism
dre  Danio rerio (zebrafish)
Brite
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   561322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
25
AA seq 124 aa AA seqDB search
MPEPAKAAPKKGSKKAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccagcaaaagccgcacccaagaagggctccaagaaagcggtcactaagacc
gcaggaaaaggaggaaagaagcgcaagaggaccaggaaggaaagctacgctatctacgtc
tacaaagtgttgaagcaagttcacccagacaccgggatctcctccaaagcgatgggcatc
atgaactcgttcgtcaatgacatcttcgagcgcatcgccggtgaggcttctcgtctcgct
cactacaataagcgctccaccatcacttccagagagatccagaccgccgtgcgtctgctg
ctgcccggtgagctggccaaacacgccgtgtctgagggcaccaaggctgtgaccaaatac
accagctccaagtaa

DBGET integrated database retrieval system