KEGG   Danio rerio (zebrafish): 561416Help
Entry
561416            CDS       T01004                                 

Gene name
pfkpb, si:dkeyp-12a9.4
Definition
phosphofructokinase, platelet b
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    561416 (pfkpb)
   01230 Biosynthesis of amino acids
    561416 (pfkpb)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    561416 (pfkpb)
   00030 Pentose phosphate pathway
    561416 (pfkpb)
   00051 Fructose and mannose metabolism
    561416 (pfkpb)
   00052 Galactose metabolism
    561416 (pfkpb)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    561416 (pfkpb)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     561416 (pfkpb)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     561416 (pfkpb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
2
AA seq 784 aa AA seqDB search
MPDTKKYIENLSGAGKCIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIHEGYQGMVD
GGDNIKEASWESVSSMLQVGGTVIGSARCKDFRTHEGRLCAALNLVQRGITNLCVIGGDG
SLTGANLFREEWSGLLDELVQSGQISEDAAQTHSALHIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPERPPKDGWE
EQMCQKLSENRADKKRLNIIIVAEGAIDQNNKPITTDHIKDLVVSRLGFDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVLALLEASPGTPACVVSLCGNQAVRVPLMECVQMTQEVQK
AMDEKRFEEAVKLRGRSFENNLNTYKLLSHRKIDTELPHSSFNVAVLNVGAPAAGMNAAV
RSAVRVGITEGHTMFAVSDGFEGFYKGQIKEIKWGDVGGWTGQGGSLLGTKRTLPAKHVD
KIAEQMRIHNINALLVIGGFEAYLGLMELQAARSKHAELCVPMVMVPATVSNNIPGSDLS
IGADTAINAITDTCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADAAYIYEEP
FDIRDLQSNVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYSEEGKGVFDCRKNVL
GHMQQGGAPSPFDRNFGTKIAAKAMQWISKKLKEFYRDDEGRVFANTEDSACLLGMRRRA
LLFQPVVQLKDETDFVHRIPKEQWWLRLRPLMKILAKYKTSYDVSDSGQLEHIVRLRAKD
SSAI
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgccggacactaaaaaatacatcgagaatctctctggagcggggaagtgcatcggcgtc
ctgacgagcggaggagatgctcaaggtatgaatgctgctgtgagggcagtggtcagaatg
ggaatctatgtaggagcaaaggtttattttatccatgagggctaccagggcatggtggat
ggaggcgataacatcaaggaggcatcatgggaaagtgtttccagtatgttacaagtgggt
ggcacagtgatcggcagtgcccgatgtaaggatttccgcacacacgaggggcgtttgtgt
gccgccctgaacctggttcaacgtggtatcaccaacctgtgtgtgattggtggagacggc
agtttgaccggtgctaatctcttcagggaggagtggagcggactgctggatgagcttgtc
caatcaggtcagatcagcgaggatgctgcccaaactcattctgccctgcatatcgtcggg
atggtgggctctatagataatgatttctgtgggacagatatgaccattggcactgactca
gcactgcacaggatcatagaggtggtggacgctattatgaccacagcgcagagccatcag
aggacctttgtgctggaggttatggggagacactgtgggtatctagcattagtcagtgct
cttgcgtgtggtgctgactgggtgctgattccagaacggcctcctaaagacggctgggag
gaacagatgtgtcagaaactatcagagaatcgtgctgataagaaacggcttaatatcatc
atagtagctgaaggtgcgatagaccaaaacaacaagcccataaccacagaccatataaag
gacctggtcgtgagccggttggggtttgacactcgggtcaccattctgggccacgtccag
agaggaggaaccccctctgcctttgaccggattctggccagtcgcatgggagtggaggcc
gttttggctcttctcgaagcgtctcctggtactccagcatgtgtggtgtctctgtgtgga
aatcaggcggtcagggtccctctgatggagtgcgttcagatgactcaggaggttcaaaag
gccatggatgaaaagagattcgaagaagccgtgaagctgcgtggcagaagtttcgaaaac
aacctgaacacctacaaactcttgtctcaccgcaaaattgacacagagcttccacatagt
tcgtttaatgtggccgtgttgaatgttggcgctcctgcggctggtatgaatgctgccgtg
cgctcagcagttagagtcggcatcactgaaggacacaccatgtttgctgtgagcgacggg
tttgagggcttctacaaaggacagataaaagaaatcaagtggggggatgttgggggctgg
acggggcagggcgggtccctgctaggaacaaaacgaaccctcccagcaaaacatgtggat
aaaattgcagagcagatgaggattcacaacataaacgctttactggttattgggggattt
gaggcatatttgggtctgatggagctccaagcagctcgctccaaacacgcagagctatgt
gtgccgatggtgatggtcccggccactgtgtccaacaatattcccggctcagacctgagc
atcggggcagacacggccatcaacgccatcacagacacgtgtgaccgtataaagcagtcg
gccagcgggacgaagcgtcgcgtgttcattatcgagaccatggggggttattgtggatat
ctggcaaccgtaggtggtcttgcagctggagctgatgctgcgtacatctacgaggagccg
tttgacatccgagacctgcagtctaacgtcgagcatttaacagagaagatgaagaccagc
atccagagaggactagtgctcaggaatgagaacagcaatgagaactacaccactgacttc
atctatcagctgtactctgaagagggtaaaggagtgtttgactgcaggaagaatgtcctg
ggacacatgcagcagggtggcgctccttcaccatttgacaggaactttggcacgaagatc
gcagctaaagccatgcaatggatctccaagaagctcaaagagttttacagagacgatgaa
ggccgtgtgtttgcgaacactgaagactctgcatgtttgctggggatgcggcgcagggct
ctgctcttccagcctgttgttcagctcaaagacgagacagattttgttcacagaatcccg
aaggagcagtggtggctccgtctgcggccgctcatgaagattctggccaaatacaaaacc
agctacgacgtgtcggattcaggccagctggagcacatcgtccggctccgagctaaagac
agctccgccatttaa

DBGET integrated database retrieval system