KEGG   Danio rerio (zebrafish): 561670Help
Entry
561670            CDS       T01004                                 

Gene name
sos2
Definition
(RefSeq) son of sevenless homolog 2
  KO
K03099  son of sevenless
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04150  mTOR signaling pathway
dre04510  Focal adhesion
dre04540  Gap junction
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    561670 (sos2)
   04012 ErbB signaling pathway
    561670 (sos2)
   04068 FoxO signaling pathway
    561670 (sos2)
   04150 mTOR signaling pathway
    561670 (sos2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    561670 (sos2)
   04540 Gap junction
    561670 (sos2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    561670 (sos2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    561670 (sos2)
   04912 GnRH signaling pathway
    561670 (sos2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH
Motif
Other DBs
NCBI-GeneID: 561670
NCBI-ProteinID: NP_001334612
ZFIN: ZDB-GENE-090319-5
Ensembl: ENSDARG00000060506
Vega: OTTDARG00000029600
UniProt: F1R019
Position
13
AA seq 1341 aa AA seqDB search
MQHDFSSSEENSARWRGLFVQGLRKVQVQVHPNLSAKEDALQHIEALILQLLNKLCVTQP
RTIADVEDRVQKTFPNPIDKWAMGDAQNAIEKRKRRNPLLLPVDKIHPLLKEVLGYKIDY
NVCLYIVAVLEYISADILKLAGNYVSNIRHYEISQQDITVSMCADKVLMDMFDQEEEMGL
LSQSVEEVSSSGVLTYDDLVRLEIAEERQYLRELDLIIKVFRQAFMSNSKLFSAQDVELA
FSNILEVQELTVKLLGLIEDAVEMTADGSPHPLVGSCFEDLAEEQAFDPYETLSQDILSK
EFCQHFNTLMSRPTVALHFQSIAEGFKEAVQYVLPQLMMVPVYHCIHYFELLQQLQECSE
EQDDRECLKQAQTALINLQCSIERIYAKHQPRRKQGEPLYRLYSRASRSKQAAIKRMNDI
QKSIDGWEGKDIGQCCSQFILEGALLRAGAKHERHNFLFDGLMISCKANQSSRLPGAGSG
AEFRLKEKFVLRKYRIVDREDSPEFRHAFELVGREESGAVFSARSAEEKSAWMAALVTLQ
YRPTLDRMLDTVLHREEQAQPLRLPSPDVYRFAIQDSEENIVFEEGAQSKTGIPIIKAGT
VVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQDLLTLLIERIEIPEPEPSEADREALWN
GEQPMAAELQRFRREYVQPVQLRVLNVFRQWVEHHFYDFENDPELYERLEGYLISTTQLR
GKSMRKWVESISKIMRRKIQMQSNGISHNITFESPPPPIEWHISRPGQVDTFDLMTLHPI
EIARQLTLLESDLYRAVRPSELVGSVWTKEDKEKNSPNLLRMIRHTTNLTLWFEKCIVEA
ENVDERVAVFSRIIEILQVFQELNNFNGVLEIVSAINSVPVYRLDHTFEAVPERKRRILE
EAVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRDGKELINFSKRR
KVAEITGEIQQYQNQPYCLKVEHDIKRFFENLNPMGNMNEKDFSDYLFNKSLEIEPRNSK
QPPRFPRKTTYSLKSPGVRPVRQAVGGGGTLKGHPVPLEREPPHKITFRSIAETEPETPP
SLPTSPNTPTPPQSASSDFNSVFEQDFMPYGNNTIFAPVFLPQSKFQSVSCGSLHQLMSD
EPLKPPPLPPRRKDTSSDKNSRSDSPPAIPPRLPPPPRLQPRVPVINGPTDGPLPSPPPP
LPRDPLPDTPPPVPQRPPEIFINYPVNMQPSPGGRFHWDFTTSPSTPNTPPGTPSPRAVL
PGTPSPRVPRRPCTPSVSQPILVHLPPPTPAPPIPPRHNSTSALPKLPPKTYKRELSQSS
HTLSQPSLHTLSLVDNRDSNE
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacgacttcagctccagcgaggagaacagcgcgagatggcgaggcctgttcgtg
caggggctgcgaaaggtgcaggtgcaagtgcatccaaacctgtcggctaaagaagatgca
ctccagcacattgaggcacttatactgcagctcctgaacaagctgtgtgttacacagccc
agaacaatagctgatgtagaggaccgcgtccagaagacgttcccaaatcccatcgataaa
tgggccatgggtgacgctcagaatgcaatagagaaacgcaagcgaagaaacccgctgctg
ctgccagttgataagatacatccactactgaaggaggtgctgggctataagatcgactat
aatgtgtgtctatatattgttgctgtgctggagtacatctcagctgacatcctcaagctg
gctggaaactacgtgagcaacattcgacattatgagatcagccagcaggacatcactgtc
tccatgtgtgctgataaggtgttaatggatatgttcgatcaagaagaggagatggggctg
ttgtctcagagtgtggaggaggtgtcttcatctggtgtgctcacatatgatgacctggtg
cgtctggagatcgcggaggagcgtcagtatctgcgggagctcgatctcatcatcaaagta
ttccgccaagcctttatgtccaatagcaaactcttctccgctcaggatgtggagctggcg
ttcagtaatattctagaggttcaggagttaacagtgaaactgttgggtcttattgaggat
gcggtagaaatgacagctgacgggagtccacaccctcttgtgggcagctgctttgaagac
ctcgctgaagagcaggcatttgatccctatgagacgctctctcaggacatcctctctaaa
gaattctgtcaacatttcaacacactgatgtcccgccccactgtagctctgcacttccag
tcaattgcagaaggctttaaggaggcagtgcagtacgtgcttcctcagttgatgatggtt
ccagtttaccactgcattcactattttgaactgttacagcaattgcaggagtgcagtgaa
gagcaagatgacagagagtgtttgaaacaggcacagactgcactgatcaacctacaatgc
agcattgaacgcatatatgctaagcaccaaccacggcgcaaacaaggggaaccactgtat
cgattgtatagtcgtgcatctcgtagcaagcaggcggctataaagcgtatgaacgacatc
cagaagagtattgatggctgggagggcaaagacattggtcagtgttgtagccagttcatc
ctggagggggcactccttcgggctggtgccaaacatgagcggcacaactttctattcgat
ggcctcatgataagctgcaaagccaatcagagctccaggttgccaggagcaggcagtggg
gcagagtttcgtctgaaagagaagttcgtgttacgcaaatatcgcattgtagatcgcgag
gattcaccagagttccgtcatgcatttgagctggtgggccgtgaggaaagcggagcagtg
tttagtgcccgttcagcagaagaaaagagtgcatggatggctgcgctggtcactctgcag
taccggcccacactggaccgcatgctggacactgtcctgcaccgtgaagaacaagcacaa
ccactgaggctgccatcaccagacgtctaccggttcgccatccaggactccgaagagaat
atcgtgttcgaggaaggagcacaaagcaagactggaatccccattattaaagctgggaca
gtggtcaagctcattgagagactgacgtaccacatgtacgcagacccaaattttgtgcgt
acgtttctgactacataccgctctttctgcaaaccacaagacctgctcacactactgatt
gaaaggattgagattccagagcccgaaccatcagaagcagatcgagaagctctctggaat
ggagaacaaccaatggcagctgagcttcagagatttcgcagagaatacgtgcagcccgtc
caactcagggtcttgaatgtgttccgtcagtgggtggaacatcacttttatgactttgag
aatgatcctgaactctacgagagacttgaaggatatcttatcagcaccacacagcttaga
ggtaaatctatgcgtaagtgggtggagtctatcagtaagatcatgagacggaagatacaa
atgcagtctaacggcattagtcacaacattacctttgagagcccacctccacccatcgaa
tggcacatcagtcgccctgggcaggtcgacacctttgacctcatgacccttcatccgata
gaaattgctcgccagttaacacttctggagtctgatctgtacagagctgttcgtccgtct
gagctcgtaggaagtgtttggacaaaggaagataaagagaagaactctcccaatctgctg
aggatgatcagacacacaaccaatctcacactgtggtttgaaaagtgtatagtagaggct
gaaaatgtagacgagagggttgctgtattttctcgcattattgagatcctgcaggtgttt
caagagcttaataactttaatggggttttggagattgtgagcgccatcaattctgtaccg
gtgtatcgtctggaccacacatttgaggcagtgcctgagaggaagaggaggattctagaa
gaagctgttgaactcagtcaggatcattttaagaaatatctcgccaaactcaagtccatc
aacccaccctgtgtacctttctttggtatctacctgactaacattctgaagactgaagag
gggaatccagatttcctaaagcgggacggaaaagaactgatcaacttcagcaagagacgc
aaagtagcagaaatcactggagaaatccagcagtaccagaaccaaccctactgcctcaaa
gtggaacacgacataaagaggttttttgagaatctgaatccaatggggaatatgaatgaa
aaggatttctctgactatttgttcaataagtctttagaaatcgaaccacggaacagcaag
cagccacctagatttcccagaaagactacatattctctgaagtctccgggcgttcggcct
gtgcgccaggcggtaggtggaggagggacgctaaaaggtcacccagtgccattagaaaga
gaaccacctcacaaaatcaccttcaggagcatcgcagaaactgaacccgagacgcctccc
tctctgcccacctctccaaacacacccacccctccgcagtccgccagctctgacttcaac
tctgtgtttgagcaggacttcatgccctacggtaacaacaccatatttgccccagttttt
ctgccgcagtccaagttccagtctgtgtcatgtggtagtttacaccagttgatgagtgat
gagccactcaagccccctccattacctcctcgcaggaaagatacttcttcagataagaat
tccaggtctgacagtcctcctgccattccaccacgattgcctcctcctccccgcctgcag
ccgcgtgtcccagtgatcaacgggccgacggatgggcccttgccgagccccccaccacct
ctgccccgtgacccccttccggacactcctccaccagtgccccagagaccacccgagatc
ttcatcaactacccagtgaacatgcagccatctccagggggccgtttccactgggacttc
accacctcacctagcactcctaataccccgcctggcaccccctctccccgtgctgtcctc
cctggaaccccttctccacgtgtgccccggcgcccctgcacacccagcgtcagtcaaccc
atactggttcaccttcctcccccgacaccggcacctcccatcccgcctcggcacaactcc
acctccgccctgccaaaactgccacccaagacttacaaaagagaactgtctcaatcttca
cacactctttctcagccctccctacacacactctcgctagttgacaacagggacagcaac
gaataa

DBGET integrated database retrieval system