KEGG   Danio rerio (zebrafish): 561670Help
Entry
561670            CDS       T01004                                 

Gene name
sos2, si:ch211-67f24.8
Definition
son of sevenless homolog 2 (Drosophila)
Orthology
K03099  
son of sevenless
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Focal adhesion
Gap junction
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:dre04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:dre04012]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:dre04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dre04068]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:dre04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:dre04510]
Cellular Processes; Cell communication; Gap junction [PATH:dre04540]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:dre04910]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:dre04912]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:dre04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Position
13
AA seq 1341 aa AA seqDB search
MQHDFSSSEENSARWRGLFVQGLRKVQVQVHPNLSAKEDALQHIEALILQLLNKLCVTQP
RTIADVEDRVQKTFPNPIDKWAMGDAQNAIEKRKRRNPLLLPVDKIHPLLKEVLGYKIDY
NVCLYIVAVLEYISADILKLAGNYVSNIRHYEISQQDITVSMCADKVLMDMFDQEEEMGL
LSQSVEEVSSSGVLTYDDLVRLEIAEERQYLRELDLIIKVFRQAFMSNSKLFSAQDVELA
FSNILEVQELTVKLLGLIEDAVEMTADGSPHPLVGSCFEDLAEEQAFDPYETLSQDILSK
EFCQHFNTLMSRPTVALHFQSIAEGFKEAVQYVLPQLMMVPVYHCIHYFELLQQLQECSE
EQDDRECLKQAQTALINLQCSIERIYAKHQPRRKQGEPLYRLYSRASRSKQAAIKRMNDI
QKSIDGWEGKDIGQCCSQFILEGALLRAGAKHERHNFLFDGLMISCKANQSSRLPGAGSG
AEFRLKEKFVLRKYRIVDREDSPEFRHAFELVGREESGAVFSARSAEEKSAWMAALVTLQ
YRPTLDRMLDTVLHREEQAQPLRLPSPDVYRFAIQDSEENIVFEEGAQSKTGIPIIKAGT
VVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQDLLTLLIERIEIPEPEPSEADREALWN
GEQPMAAELQRFRREYVQPVQLRVLNVFRQWVEHHFYDFENDPELYERLEGYLISTTQLR
GKSMRKWVESISKIMRRKIQMQSNGISHNITFESPPPPIEWHISRPGQVDTFDLMTLHPI
EIARQLTLLESDLYRAVRPSELVGSVWTKEDKEKNSPNLLRMIRHTTNLTLWFEKCIVEA
ENVDERVAVFSRIIEILQVFQELNNFNGVLEIVSAINSVPVYRLDHTFEAVPERKRRILE
EAVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRDGKELINFSKRR
KVAEITGEIQQYQNQPYCLKVEHDIKRFFENLNPMGNMNEKDFSDYLFNKSLEIEPRNSK
QPPRFPRKTTYSLKSPGVRPVRQAVGGGGTLKGHPVPLEREPPHKITFRSIAETEPETPP
SLPTSPNTPTPPQSASSDFNSVFEQDFMPYGNNTIFAPVFLPQSKFQSVSCGSLHQLMSD
EPLKPPPLPPRRKDTSSDKNSRSDSPPAIPPRLPPPPRLQPRVPVINGPTDGPLPSPPPP
LPRDPLPDTPPPVPQRPPEIFINYPVNMQPSPGGRFHWDFTTSPSTPNTPPGTPSPRAVL
PGTPSPRVPRRPCTPSVSQPILVHLPPPTPAPPIPPRHNSTSALPKLPPKTYKRELSQSS
HTLSQPSLHTLSLVDNRDSNE
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacgacttcagctccagcgaggagaacagcgcgagatggcgaggcctgttcgtg
caggggctgcgaaaggtgcaggtgcaagtgcatccaaacctgtcggctaaagaagatgca
ctccagcacattgaggcacttatactgcagctcctgaacaagctgtgtgttacacagccc
agaacaatagctgatgtagaggaccgcgtccagaagacgttcccaaatcccatcgataaa
tgggccatgggtgacgctcagaatgcaatagagaaacgcaagcgaagaaacccgctgctg
ctgccagttgataagatacatccactactgaaggaggtgctgggctataagatcgactat
aatgtgtgtctatatattgttgctgtgctggagtacatctcagctgacatcctcaagctg
gctggaaactacgtgagcaacattcgacattatgagatcagccagcaggacatcactgtc
tccatgtgtgctgataaggtgttaatggatatgttcgatcaagaagaggagatggggctg
ttgtctcagagtgtggaggaggtgtcttcatctggtgtgctcacatatgatgacctggtg
cgtctggagatcgcggaggagcgtcagtatctgcgggagctcgatctcatcatcaaagta
ttccgccaagcctttatgtccaatagcaaactcttctccgctcaggatgtggagctggcg
ttcagtaatattctagaggttcaggagttaacagtgaaactgttgggtcttattgaggat
gcggtagaaatgacagctgacgggagtccacaccctcttgtgggcagctgctttgaagac
ctcgctgaagagcaggcatttgatccctatgagacgctctctcaggacatcctctctaaa
gaattctgtcaacatttcaacacactgatgtcccgccccactgtagctctgcacttccag
tcaattgcagaaggctttaaggaggcagtgcagtacgtgcttcctcagttgatgatggtt
ccagtttaccactgcattcactattttgaactgttacagcaattgcaggagtgcagtgaa
gagcaagatgacagagagtgtttgaaacaggcacagactgcactgatcaacctacaatgc
agcattgaacgcatatatgctaagcaccaaccacggcgcaaacaaggggaaccactgtat
cgattgtatagtcgtgcatctcgtagcaagcaggcggctataaagcgtatgaacgacatc
cagaagagtattgatggctgggagggcaaagacattggtcagtgttgtagccagttcatc
ctggagggggcactccttcgggctggtgccaaacatgagcggcacaactttctattcgat
ggcctcatgataagctgcaaagccaatcagagctccaggttgccaggagcaggcagtggg
gcagagtttcgtctgaaagagaagttcgtgttacgcaaatatcgcattgtagatcgcgag
gattcaccagagttccgtcatgcatttgagctggtgggccgtgaggaaagcggagcagtg
tttagtgcccgttcagcagaagaaaagagtgcatggatggctgcgctggtcactctgcag
taccggcccacactggaccgcatgctggacactgtcctgcaccgtgaagaacaagcacaa
ccactgaggctgccatcaccagacgtctaccggttcgccatccaggactccgaagagaat
atcgtgttcgaggaaggagcacaaagcaagactggaatccccattattaaagctgggaca
gtggtcaagctcattgagagactgacgtaccacatgtacgcagacccaaattttgtgcgt
acgtttctgactacataccgctctttctgcaaaccacaagacctgctcacactactgatt
gaaaggattgagattccagagcccgaaccatcagaagcagatcgagaagctctctggaat
ggagaacaaccaatggcagctgagcttcagagatttcgcagagaatacgtgcagcccgtc
caactcagggtcttgaatgtgttccgtcagtgggtggaacatcacttttatgactttgag
aatgatcctgaactctacgagagacttgaaggatatcttatcagcaccacacagcttaga
ggtaaatctatgcgtaagtgggtggagtctatcagtaagatcatgagacggaagatacaa
atgcagtctaacggcattagtcacaacattacctttgagagcccacctccacccatcgaa
tggcacatcagtcgccctgggcaggtcgacacctttgacctcatgacccttcatccgata
gaaattgctcgccagttaacacttctggagtctgatctgtacagagctgttcgtccgtct
gagctcgtaggaagtgtttggacaaaggaagataaagagaagaactctcccaatctgctg
aggatgatcagacacacaaccaatctcacactgtggtttgaaaagtgtatagtagaggct
gaaaatgtagacgagagggttgctgtattttctcgcattattgagatcctgcaggtgttt
caagagcttaataactttaatggggttttggagattgtgagcgccatcaattctgtaccg
gtgtatcgtctggaccacacatttgaggcagtgcctgagaggaagaggaggattctagaa
gaagctgttgaactcagtcaggatcattttaagaaatatctcgccaaactcaagtccatc
aacccaccctgtgtacctttctttggtatctacctgactaacattctgaagactgaagag
gggaatccagatttcctaaagcgggacggaaaagaactgatcaacttcagcaagagacgc
aaagtagcagaaatcactggagaaatccagcagtaccagaaccaaccctactgcctcaaa
gtggaacacgacataaagaggttttttgagaatctgaatccaatggggaatatgaatgaa
aaggatttctctgactatttgttcaataagtctttagaaatcgaaccacggaacagcaag
cagccacctagatttcccagaaagactacatattctctgaagtctccgggcgttcggcct
gtgcgccaggcggtaggtggaggagggacgctaaaaggtcacccagtgccattagaaaga
gaaccacctcacaaaatcaccttcaggagcatcgcagaaactgaacccgagacgcctccc
tctctgcccacctctccaaacacacccacccctccgcagtccgccagctctgacttcaac
tctgtgtttgagcaggacttcatgccctacggtaacaacaccatatttgccccagttttt
ctgccgcagtccaagttccagtctgtgtcatgtggtagtttacaccagttgatgagtgat
gagccactcaagccccctccattacctcctcgcaggaaagatacttcttcagataagaat
tccaggtctgacagtcctcctgccattccaccacgattgcctcctcctccccgcctgcag
ccgcgtgtcccagtgatcaacgggccgacggatgggcccttgccgagccccccaccacct
ctgccccgtgacccccttccggacactcctccaccagtgccccagagaccacccgagatc
ttcatcaactacccagtgaacatgcagccatctccagggggccgtttccactgggacttc
accacctcacctagcactcctaataccccgcctggcaccccctctccccgtgctgtcctc
cctggaaccccttctccacgtgtgccccggcgcccctgcacacccagcgtcagtcaaccc
atactggttcaccttcctcccccgacaccggcacctcccatcccgcctcggcacaactcc
acctccgccctgccaaaactgccacccaagacttacaaaagagaactgtctcaatcttca
cacactctttctcagccctccctacacacactctcgctagttgacaacagggacagcaac
gaataa

DBGET integrated database retrieval system