KEGG   Danio rerio (zebrafish): 561670Help
Entry
561670            CDS       T01004                                 

Gene name
sos2, si:ch211-67f24.8
Definition
son of sevenless homolog 2 (Drosophila)
Orthology
K03099  
son of sevenless
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Focal adhesion
Gap junction
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    561670 (sos2)
   04012 ErbB signaling pathway
    561670 (sos2)
   04630 Jak-STAT signaling pathway
    561670 (sos2)
   04068 FoxO signaling pathway
    561670 (sos2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    561670 (sos2)
  Cellular commiunity
   04510 Focal adhesion
    561670 (sos2)
   04540 Gap junction
    561670 (sos2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    561670 (sos2)
   04912 GnRH signaling pathway
    561670 (sos2)
  Development
   04320 Dorso-ventral axis formation
    561670 (sos2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Position
13
AA seq 1341 aa AA seqDB search
MQHDFSSSEENSARWRGLFVQGLRKVQVQVHPNLSAKEDALQHIEALILQLLNKLCVTQP
RTIADVEDRVQKTFPNPIDKWAMGDAQNAIEKRKRRNPLLLPVDKIHPLLKEVLGYKIDY
NVCLYIVAVLEYISADILKLAGNYVSNIRHYEISQQDITVSMCADKVLMDMFDQEEEMGL
LSQSVEEVSSSGVLTYDDLVRLEIAEERQYLRELDLIIKVFRQAFMSNSKLFSAQDVELA
FSNILEVQELTVKLLGLIEDAVEMTADGSPHPLVGSCFEDLAEEQAFDPYETLSQDILSK
EFCQHFNTLMSRPTVALHFQSIAEGFKEAVQYVLPQLMMVPVYHCIHYFELLQQLQECSE
EQDDRECLKQAQTALINLQCSIERIYAKHQPRRKQGEPLYRLYSRASRSKQAAIKRMNDI
QKSIDGWEGKDIGQCCSQFILEGALLRAGAKHERHNFLFDGLMISCKANQSSRLPGAGSG
AEFRLKEKFVLRKYRIVDREDSPEFRHAFELVGREESGAVFSARSAEEKSAWMAALVTLQ
YRPTLDRMLDTVLHREEQAQPLRLPSPDVYRFAIQDSEENIVFEEGAQSKTGIPIIKAGT
VVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQDLLTLLIERIEIPEPEPSEADREALWN
GEQPMAAELQRFRREYVQPVQLRVLNVFRQWVEHHFYDFENDPELYERLEGYLISTTQLR
GKSMRKWVESISKIMRRKIQMQSNGISHNITFESPPPPIEWHISRPGQVDTFDLMTLHPI
EIARQLTLLESDLYRAVRPSELVGSVWTKEDKEKNSPNLLRMIRHTTNLTLWFEKCIVEA
ENVDERVAVFSRIIEILQVFQELNNFNGVLEIVSAINSVPVYRLDHTFEAVPERKRRILE
EAVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRDGKELINFSKRR
KVAEITGEIQQYQNQPYCLKVEHDIKRFFENLNPMGNMNEKDFSDYLFNKSLEIEPRNSK
QPPRFPRKTTYSLKSPGVRPVRQAVGGGGTLKGHPVPLEREPPHKITFRSIAETEPETPP
SLPTSPNTPTPPQSASSDFNSVFEQDFMPYGNNTIFAPVFLPQSKFQSVSCGSLHQLMSD
EPLKPPPLPPRRKDTSSDKNSRSDSPPAIPPRLPPPPRLQPRVPVINGPTDGPLPSPPPP
LPRDPLPDTPPPVPQRPPEIFINYPVNMQPSPGGRFHWDFTTSPSTPNTPPGTPSPRAVL
PGTPSPRVPRRPCTPSVSQPILVHLPPPTPAPPIPPRHNSTSALPKLPPKTYKRELSQSS
HTLSQPSLHTLSLVDNRDSNE
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacgacttcagctccagcgaggagaacagcgcgagatggcgaggcctgttcgtg
caggggctgcgaaaggtgcaggtgcaagtgcatccaaacctgtcggctaaagaagatgca
ctccagcacattgaggcacttatactgcagctcctgaacaagctgtgtgttacacagccc
agaacaatagctgatgtagaggaccgcgtccagaagacgttcccaaatcccatcgataaa
tgggccatgggtgacgctcagaatgcaatagagaaacgcaagcgaagaaacccgctgctg
ctgccagttgataagatacatccactactgaaggaggtgctgggctataagatcgactat
aatgtgtgtctatatattgttgctgtgctggagtacatctcagctgacatcctcaagctg
gctggaaactacgtgagcaacattcgacattatgagatcagccagcaggacatcactgtc
tccatgtgtgctgataaggtgttaatggatatgttcgatcaagaagaggagatggggctg
ttgtctcagagtgtggaggaggtgtcttcatctggtgtgctcacatatgatgacctggtg
cgtctggagatcgcggaggagcgtcagtatctgcgggagctcgatctcatcatcaaagta
ttccgccaagcctttatgtccaatagcaaactcttctccgctcaggatgtggagctggcg
ttcagtaatattctagaggttcaggagttaacagtgaaactgttgggtcttattgaggat
gcggtagaaatgacagctgacgggagtccacaccctcttgtgggcagctgctttgaagac
ctcgctgaagagcaggcatttgatccctatgagacgctctctcaggacatcctctctaaa
gaattctgtcaacatttcaacacactgatgtcccgccccactgtagctctgcacttccag
tcaattgcagaaggctttaaggaggcagtgcagtacgtgcttcctcagttgatgatggtt
ccagtttaccactgcattcactattttgaactgttacagcaattgcaggagtgcagtgaa
gagcaagatgacagagagtgtttgaaacaggcacagactgcactgatcaacctacaatgc
agcattgaacgcatatatgctaagcaccaaccacggcgcaaacaaggggaaccactgtat
cgattgtatagtcgtgcatctcgtagcaagcaggcggctataaagcgtatgaacgacatc
cagaagagtattgatggctgggagggcaaagacattggtcagtgttgtagccagttcatc
ctggagggggcactccttcgggctggtgccaaacatgagcggcacaactttctattcgat
ggcctcatgataagctgcaaagccaatcagagctccaggttgccaggagcaggcagtggg
gcagagtttcgtctgaaagagaagttcgtgttacgcaaatatcgcattgtagatcgcgag
gattcaccagagttccgtcatgcatttgagctggtgggccgtgaggaaagcggagcagtg
tttagtgcccgttcagcagaagaaaagagtgcatggatggctgcgctggtcactctgcag
taccggcccacactggaccgcatgctggacactgtcctgcaccgtgaagaacaagcacaa
ccactgaggctgccatcaccagacgtctaccggttcgccatccaggactccgaagagaat
atcgtgttcgaggaaggagcacaaagcaagactggaatccccattattaaagctgggaca
gtggtcaagctcattgagagactgacgtaccacatgtacgcagacccaaattttgtgcgt
acgtttctgactacataccgctctttctgcaaaccacaagacctgctcacactactgatt
gaaaggattgagattccagagcccgaaccatcagaagcagatcgagaagctctctggaat
ggagaacaaccaatggcagctgagcttcagagatttcgcagagaatacgtgcagcccgtc
caactcagggtcttgaatgtgttccgtcagtgggtggaacatcacttttatgactttgag
aatgatcctgaactctacgagagacttgaaggatatcttatcagcaccacacagcttaga
ggtaaatctatgcgtaagtgggtggagtctatcagtaagatcatgagacggaagatacaa
atgcagtctaacggcattagtcacaacattacctttgagagcccacctccacccatcgaa
tggcacatcagtcgccctgggcaggtcgacacctttgacctcatgacccttcatccgata
gaaattgctcgccagttaacacttctggagtctgatctgtacagagctgttcgtccgtct
gagctcgtaggaagtgtttggacaaaggaagataaagagaagaactctcccaatctgctg
aggatgatcagacacacaaccaatctcacactgtggtttgaaaagtgtatagtagaggct
gaaaatgtagacgagagggttgctgtattttctcgcattattgagatcctgcaggtgttt
caagagcttaataactttaatggggttttggagattgtgagcgccatcaattctgtaccg
gtgtatcgtctggaccacacatttgaggcagtgcctgagaggaagaggaggattctagaa
gaagctgttgaactcagtcaggatcattttaagaaatatctcgccaaactcaagtccatc
aacccaccctgtgtacctttctttggtatctacctgactaacattctgaagactgaagag
gggaatccagatttcctaaagcgggacggaaaagaactgatcaacttcagcaagagacgc
aaagtagcagaaatcactggagaaatccagcagtaccagaaccaaccctactgcctcaaa
gtggaacacgacataaagaggttttttgagaatctgaatccaatggggaatatgaatgaa
aaggatttctctgactatttgttcaataagtctttagaaatcgaaccacggaacagcaag
cagccacctagatttcccagaaagactacatattctctgaagtctccgggcgttcggcct
gtgcgccaggcggtaggtggaggagggacgctaaaaggtcacccagtgccattagaaaga
gaaccacctcacaaaatcaccttcaggagcatcgcagaaactgaacccgagacgcctccc
tctctgcccacctctccaaacacacccacccctccgcagtccgccagctctgacttcaac
tctgtgtttgagcaggacttcatgccctacggtaacaacaccatatttgccccagttttt
ctgccgcagtccaagttccagtctgtgtcatgtggtagtttacaccagttgatgagtgat
gagccactcaagccccctccattacctcctcgcaggaaagatacttcttcagataagaat
tccaggtctgacagtcctcctgccattccaccacgattgcctcctcctccccgcctgcag
ccgcgtgtcccagtgatcaacgggccgacggatgggcccttgccgagccccccaccacct
ctgccccgtgacccccttccggacactcctccaccagtgccccagagaccacccgagatc
ttcatcaactacccagtgaacatgcagccatctccagggggccgtttccactgggacttc
accacctcacctagcactcctaataccccgcctggcaccccctctccccgtgctgtcctc
cctggaaccccttctccacgtgtgccccggcgcccctgcacacccagcgtcagtcaaccc
atactggttcaccttcctcccccgacaccggcacctcccatcccgcctcggcacaactcc
acctccgccctgccaaaactgccacccaagacttacaaaagagaactgtctcaatcttca
cacactctttctcagccctccctacacacactctcgctagttgacaacagggacagcaac
gaataa

DBGET integrated database retrieval system