KEGG   Danio rerio (zebrafish): 561747Help
Entry
561747            CDS       T01004                                 

Gene name
plcg2, fj85b03, si:ch211-260p9.2, wu:fj85b03, zgc:152893
Definition
phospholipase C, gamma 2 (EC:3.1.4.11)
Orthology
K05859  
phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    561747 (plcg2)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    561747 (plcg2)
   04370 VEGF signaling pathway
    561747 (plcg2)
   04020 Calcium signaling pathway
    561747 (plcg2)
   04070 Phosphatidylinositol signaling system
    561747 (plcg2)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     561747 (plcg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
18
AA seq 1240 aa AA seqDB search
MAGRAHQGDLTEYKKSLIKRDLEMGIVMTVYRQRIERLTVQVIMETRQVAWSRTANKTEG
VLDIFEIREVRPGKNSKEFDRFKDHKDRNTDPNTCFTIFYGSQFVLNTLSLGADSVEDAE
KWLTGLELLRDETLAAHTPEIIESWLRKQMYSVDQTKKNSITMKELKSLLPQMNFKVPCG
RFLKDKFAALGAKKEVLDFEQFHKFYNSLIFENQKSILDEFKKETCAFILGNGDQPIQLS
DFQRFLLYQQRETWANNLNQVRELMTIFIDDTMRETNDPAFILEEFLSFLFSKENQIWDD
KFSEICPLDMNNPLSHYWINSSHNTYLTGDQLRSESSTEAYVRCLRLGCRCVELDCWNGP
EEPIIYHGWTRTSKIKFKDVVKAINDHAFATSEYPVVLSIEEHCDVKQQKMMAQVFKDVF
QDKILMEPLEPEAEQLPSPTQLKGKIIIKHKKLNIDQTFGRKDLRKGDKQGELFIWDPID
ERWYRHYCVIENKTLYYAEENDEEEEKSVQSCTELHQSEPWFHGRMSEGRMTAERLLQEY
CAESGGVDGTFLVRESDTFVNDCTLSFWRSGRVQHCRIRSCLEGGHTVYFLTENLHFPSV
YALIYYYRDNLLRCQDFNLRLTEYVPKPDTHQLEGWFYSNLSRGEAEDYLMRIPRDGAFL
IRQREDSDSYAITFRGEGLVKHCRIHKDGSMYILGTSSEFDSLVELVDYFRKKPLYRKTK
LRYPVTPELVERFSSINKTGSLYDSKQYVEANEIEPSLPQNTVKALYDYRAMRPDELTFS
KGVLIHNVTRDTNGWWKGDYGGKLQHYFPSNYVEEVQSDANYQPEEENPLGELCKGTVDI
SKCTVVRSAKHGKQVVVTLQYKEDKENMMPFDLATETTEELYEWYQVAWDITQREENLVF
EKEKTKEVETRDEVASEMSELVVYCQPRSKEKDGFDNYTYKEVRSFVENKTPSRNKLTQF
MLYNRKALSRIYPKGQRVDSSNYDPYPLWMCGCHMVALNFQTADKYTQLNSALFSLNGST
GYVLQPELMRRDSYDPQQERKNIKYTIGIRVIGARHLPKPGRSIASPFVEIELCGQTDES
KFKTTVCHDNGLNPIWQPSEMFVFSVYEPDLTFLRFVVFEEDMFSDPNFLAQATFPVKGV
RSGYRSVPLKNGFSENLELASLLVCVDVQQVEKAQEELYSSSKQLQKKQAEMSSEFCLYD
THSNLRSSGPQRREDLSQFTYSEKKINKPQQKINNSKFYS
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtcgtgctcatcagggagacctgaccgagtacaagaagagcctcatcaagcgg
gacttggagatggggatagtgatgacggtgtacaggcagaggattgagagactcacggtg
caggtcattatggagacgcggcaggtggcctggtcacgcaccgccaacaagactgaagga
gtgttggacatttttgaaatccgggaagtacgaccaggaaaaaactccaaagaatttgat
cgcttcaaggaccacaaagatagaaatacagacccaaacacatgctttaccatattctac
ggctctcagtttgttctcaacactctcagtctgggagctgattcggtggaagatgcagaa
aaatggctgacaggattggagttactcagagatgagacactggcagctcacacaccagag
attatagagagttggctgaggaaacagatgtattcagttgatcagacgaagaaaaacagc
atcaccatgaaagagctgaagtcccttttgccacagatgaactttaaagtaccttgtgga
cgctttttgaaggacaaatttgcggcattgggagcaaagaaggaggtcctggattttgag
caatttcacaaattttacaattctttgatatttgagaaccaaaagtcgattttagatgag
tttaaaaaggagacgtgtgctttcatcctgggtaatggtgatcagcctattcaactcagt
gatttccaaaggttccttttatatcagcaaagagagacttgggctaacaatctgaatcaa
gtccgagagttaatgaccatcttcatcgacgacaccatgagggaaaccaatgatcctgca
tttatccttgaagagttcctcagttttctcttctccaaagaaaaccaaatttgggatgac
aagttttccgagatttgcccactggacatgaacaatcctctgtctcactactggatcaac
tcgtctcacaacacatatttaactggagatcagctgcgtagtgagtcttcaacagaagcg
tatgtgcgctgtctgaggctgggctgtcgctgtgttgaattggactgctggaatggtcca
gaggaacctattatatatcacggctggaccagaacctccaagataaagtttaaagatgtg
gtgaaggccatcaatgatcacgctttcgcaacatctgagtatcctgtggtgctgtccata
gaagaacactgtgacgtcaagcaacagaaaatgatggctcaggtgttcaaagatgttttc
caggacaaaatcctgatggaacctctggaaccagaagcagaacaactgccatcaccaacc
cagctcaagggcaagatcatcattaagcacaaaaaactgaacatcgatcagacctttggc
agaaaggaccttcgaaaaggagataagcaaggagagctcttcatctgggatccaatagat
gagaggtggtacaggcactactgtgtgattgagaataaaacgctctattatgcggaggag
aatgatgaagaggaagaaaagtcggtccagtcttgcacggagcttcatcagtctgagccg
tggtttcatggccggatgtccgagggccgaatgactgcagaaagactgctgcaggaatac
tgtgctgaatcgggtggagttgatggaacatttctggttcgggagagtgacaccttcgta
aatgattgcacactttcattctggcgcagtggacgagttcagcattgtcgaatccgttcc
tgcttggaaggaggacacacagtttatttcctgacagaaaacctgcacttccccagcgtg
tatgctctcatctattattacagagacaacctgctccgctgtcaggatttcaacctgcgc
ctcactgaatatgtgcctaaaccagacacgcaccagttggaagggtggttttacagtaac
ttgagtcggggtgaggcggaggactatctaatgcggatccctcgagacggagccttcctc
atcagacagagagaggattcagactcgtatgccatcacattcagaggcgaaggcttggtg
aagcactgccggatacacaaagacggctctatgtacattctgggcacttctagtgagttt
gacagcctggtggaactagtggactatttccgaaagaagccgctgtatcgaaaaacaaaa
ctgcgctatcctgttacaccagaactagtagagcgcttcagttcgataaacaaaacaggt
tcgctgtatgactctaagcagtatgttgaggctaacgagatcgagccgtctctgccccag
aacacagtgaaggctctttatgactacagggcaatgcgtcctgatgagctcaccttttca
aaaggtgttttgatccataatgtgaccagggacacaaatggatggtggaaaggagactat
ggtggaaaactccagcactatttcccttcaaattacgtagaagaagtccaatctgatgcc
aattaccagcccgaagaggaaaatccattaggtgaattgtgtaaaggcacagtggacatc
tcaaagtgcactgttgttcgctctgccaaacatggcaaacaagtggtggtaactctgcag
tataaggaggataaagagaacatgatgccatttgatttggccaccgagaccactgaagag
ctgtacgagtggtatcaggtggcctgggacattacgcagagagaggaaaacctagtgttt
gagaaagaaaaaacgaaggaagtggagaccagagatgaagtggccagtgagatgtcagaa
ctggttgtttactgccagccacgcagcaaagaaaaggacggctttgataattatacctac
aaagaagtccgctccttcgtagagaataagacgccctccagaaacaagctgactcagttc
atgttgtataaccgcaaggctttgagccgcatctatcctaaaggccagcgggtggattcc
tccaactatgacccgtatccgctgtggatgtgtggctgtcacatggtagcgctcaacttc
cagacggctgataagtacactcagctgaacagcgccctcttcagtctaaatggaagcaca
ggatatgtactgcaacctgagctgatgcgcagagattcatatgaccctcaacaggagagg
aagaacatcaaatatactatcggaatcagagtgattggagcacggcatcttcccaaacca
ggacgaagtattgccagcccctttgtggagattgagctgtgtggtcaaacagatgagagc
aaattcaagactaccgtttgccatgacaatgggctgaaccctatatggcagccttcagag
atgtttgttttcagcgtgtatgagccggacctcacctttctacgctttgtggtctttgaa
gaggacatgttctctgacccaaatttccttgcccaggctacattcccagtgaaaggtgtc
cgctcaggctacagatcggttcctttaaagaatggcttcagtgaaaatctggagctggca
tctctactggtctgtgttgatgtacagcaggtggagaaagcacaggaggaactttactcc
tcctcgaaacagttgcaaaagaagcaggcggagatgagcagcgagttctgcctttacgac
actcactccaacctgcgctccagtggccctcaacgccgcgaagacctctcgcagttcact
tactctgaaaaaaagataaataaaccacagcaaaagataaacaacagcaagttctactcg
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system