KEGG   Danio rerio (zebrafish): 561901Help
Entry
561901            CDS       T01004                                 

Gene name
thbs1, Tsp-1, si:dkey-11e23.1, wu:fc48c03
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
dre  Danio rerio (zebrafish)
Pathway
p53 signaling pathway
Phagosome
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    561901 (thbs1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    561901 (thbs1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    561901 (thbs1)
  Cell growth and death
   04115 p53 signaling pathway
    561901 (thbs1)
  Cellular commiunity
   04510 Focal adhesion
    561901 (thbs1)
Heparan sulfate/heparin binding proteins [BR:dre00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  561901 (thbs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 1171 aa AA seqDB search
MKSTAIFLLLMLWNCESARVAESRDDNSVYDLFELVQVPRKNHGVTLVKGDDPYSPAYKI
LNPDLIPPVPESAFRDLIDSIHAEKGFLLLVNFKQFKRTRGSLLTVEKNDGSGPVFEIVS
NGKANTLDIVFSTENKQQVVSIEEADLAVGHWKNITLFVQEDRVQFYVGCEEVNVAELDA
SIHTILTQEIPGVAKMRIGKGAVKDRFMGVLQNVRFVFGTTLEAILRNKGCQNSAMTDII
TLDNPINGSSPAIRTDYTGHKTKDLQMICGFSCEDLAAMFKELKGLGVVVQELSNELRKV
TDDKNMLMNQMGIRAGVCLHNGIVHKNKEEWTVDDCTECTCQNSATVCRKISCPLIPCAN
ATVPDGECCPRCGTPSDSAEDGWSPWSEWTHCSVSCGRGIQQRGRSCDRINNNCEGTSVQ
TRDCYLQECDKRFKQDGSWSHWSPWSSCSVTCGAGVITRIRLCNSPTPQMDGKDCQGEGR
QTERCEKSPCPINGGWGPWSPWDTCSVTCGGGVQNRKRLCNNPVPKHGGKECVGDAKVSQ
ICNKQACPVDGCLSSPCFEGAQCTSFPDGSWKCGKCPTGYTGNGINCKDVNECKEVPDAC
FEFNGVHRCENTVPGYNCLPCPTRYTGPQPFGRGVEDAAAKKQVCTPRNPCLDGSHDCNK
NARCNYLGHFSDPMFRCECKPGFAGNGHICGEDTDLDGWPNADLVCVENATYHCKKDNCP
NLPNSGQEDYDKDGIGDACDDDDDDDGIPDDRDNCPLVFNPRQYDYDRDDVGDRCDNCPY
NSNPDQTDTDNNGEGDACAVDIDGDGILNEKDNCPYLYNVDQKDTDLDGVGDQCDNCPLE
HNPDQLDSDSDRVGDKCDSNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDYDDD
NDGIPDEKDNCRLVFNPDQLDSDGDGRGDACKDDFDMDNVLDIYDVCPENFDISETDFRK
FQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGFDEFNSVDFSGTFFINTERD
DDYAGFVFGYQSSSRFYVVMWKQITQTYWSSTPTKAQGYSGLSIKVVNSTTGPGEHLRNA
LWHTGDTPGQVRTLWHDPKNVGWKDFTAYRWHLTHRPRTGHIRVVMYEGKKIMADSGRIY
DKTYAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3516 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcaactgcaatctttttgctactgatgctttggaactgcgagagcgcgagagtc
gcagagagtcgagacgacaacagtgtttacgatctgttcgagctggtccaagtaccaagg
aaaaaccacggagtgaccctggtgaaaggcgacgacccgtacagccccgcctacaagatc
ctgaaccccgacctgatccccccggtccccgagagcgcctttagggacctaatcgattcc
attcacgccgagaaaggatttctgctgctggttaatttcaagcagttcaaacgcacgagg
ggaagcctgctgactgtggagaagaatgacggttctggacccgtgtttgaaatcgtttcc
aacgggaaagccaacactctggacattgttttttccaccgagaacaagcagcaggtcgtg
tccatcgaggaagcggacttggcggtgggacactggaaaaacatcactcttttcgtgcaa
gaggacagggttcagttctatgtgggatgtgaggaggtgaacgtggcggagctcgatgcc
tcaatccacaccatcctgactcaggagattccaggtgtggccaaaatgaggatcggtaaa
ggcgcggtgaaggacaggttcatgggggtgttgcaaaacgtgcgctttgtattcggaacc
acgctggaagccatcctgaggaataaagggtgccaaaactcagcaatgactgatatcatt
acccttgacaatcccataaatggatccagccctgcaatcaggacagattacactggccac
aaaacaaaagatctgcaaatgatttgtggcttttcatgtgaggatctggctgccatgttt
aaggaactgaaaggtcttggtgtggtggttcaagaactgtccaatgaactccgaaaagtg
acggatgacaaaaacatgctcatgaatcaaatgggcattcgtgctggtgtatgtcttcac
aatggaattgtgcacaaaaacaaggaggaatggacagtggacgactgcacagagtgcact
tgccagaattctgcaacggtgtgccgcaagatttcatgtcccctaatcccatgtgcaaat
gccacagtacctgatggagagtgctgccctcgctgtggaacaccgagcgactccgccgag
gatggttggtccccctggtctgaatggacccattgttcagtgtcctgtggaaggggcatt
cagcagcgcggccgttcctgcgaccgcatcaataacaactgtgagggcacgtcagtgcag
accagagactgctacctccaggagtgcgacaagcgctttaagcaagacggtagctggagc
cactggtcaccctggtcatcgtgttcggtcacatgtggtgctggtgttattacacgcatc
cgtctctgtaactccccgacacctcaaatggatggcaaagactgccagggtgaagggcgg
caaactgagaggtgtgagaaatcaccatgtccgatcaacggtggctggggaccatggtcg
ccctgggatacttgctctgttacctgtggtggtggcgtccaaaaccgtaagcgtctttgc
aataatcctgtacccaaacatggtggcaaagagtgtgtgggagatgcaaaggtcagccag
atttgcaacaaacaagcctgtcctgttgatggatgtctttcgagtccgtgctttgaaggg
gcccagtgcacaagctttccagatgggtcctggaaatgtggaaaatgccccacaggatac
actggcaatggaatcaactgcaaagatgtcaatgagtgtaaggaagtaccagatgcctgc
tttgaatttaatggagtccacagatgtgagaacacagtgccaggctacaactgtctccct
tgccccactcgttacaccgggccacagccgtttggccgtggagtggaggacgccgctgct
aagaagcaggtgtgcactcctcgaaatccctgcctggatggaagccacgactgcaataaa
aacgctcgctgcaactacctgggccatttctctgaccccatgttccgctgtgaatgcaaa
cctggctttgctggaaatggacacatctgtggagaagatactgatcttgatggttggccg
aatgctgatctcgtgtgtgttgagaacgcaacctatcactgcaagaaggacaactgccca
aatcttcccaactcagggcaagaagactatgacaaggatggcattggtgatgcatgtgac
gatgatgatgatgacgatggcattcctgatgacagggataactgcccactcgtcttcaac
ccgagacagtacgactatgatcgggatgatgttggtgaccgttgtgataactgtccctac
aacagcaacccagaccagacagacactgacaacaatggagaaggagacgcctgtgctgtg
gacattgatggagatggtattctgaacgagaaagacaactgtccgtatctgtacaacgtc
gaccagaaagacactgatcttgatggagttggagaccagtgtgacaactgtccattggaa
cacaacccagatcagctggactctgattctgaccgcgttggagacaaatgtgacagtaac
caggatatcgatgaagacggtcaccagaacaacctggacaactgtccatacatccccaat
gccaaccaggctgatcatgacaaggacggtaaaggagatgcctgcgactacgatgatgat
aatgatggcattcctgacgaaaaagacaactgcagactggtcttcaatccagatcagcta
gattctgatggcgatggacgtggcgatgcctgtaaagatgactttgacatggacaatgtt
ctggatatctatgatgtctgtcctgagaacttcgatatcagtgaaaccgacttccgcaag
ttccagatggttcctctggatcccaagggcacttctcagatcgatcccaactgggtggtt
cgtcatcaaggaaaagagctggttcagacagtcaactgcgaccctggcattgctgttggt
tttgatgagttcaattcagtggacttcagtggaacattcttcatcaacactgagagggat
gacgactatgctggttttgttttcggataccagtccagctctcgcttctatgtggtcatg
tggaagcagatcacacagacctactggtccagcacacctaccaaagcacagggttactca
gggctgtccatcaaagtggttaattccaccacaggacctggggagcatctgagaaacgcc
ctttggcacactggagacacaccaggacaggtgcgcacattgtggcatgacccaaagaat
gtgggatggaaggactttactgcttacagatggcacctgacacacagaccaagaactgga
cacataagagtggtcatgtatgaaggcaaaaagatcatggcagattctggcagaatctac
gacaaaacatacgcaggcggaagactaggtctcttcgtcttctcacaagagatggtgtat
ttctcagacctcaaatacgaatgcagagatgcgtaa

DBGET integrated database retrieval system