KEGG   Danio rerio (zebrafish): 561901Help
Entry
561901            CDS       T01004                                 

Gene name
thbs1b
Definition
(RefSeq) thrombospondin-1 isoform X1
  KO
K16857  
thrombospondin 1
Organism
dre  Danio rerio (zebrafish)
Pathway
p53 signaling pathway
Phagosome
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    561901 (thbs1b)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    561901 (thbs1b)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    561901 (thbs1b)
  Cell growth and death
   04115 p53 signaling pathway
    561901 (thbs1b)
  Cellular community - eukaryotes
   04510 Focal adhesion
    561901 (thbs1b)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Phagocytosis
   Opsonins
    561901 (thbs1b)
Cell adhesion molecules and their ligands [BR:dre04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     561901 (thbs1b)
Glycosaminoglycan binding proteins [BR:dre00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   561901 (thbs1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 1171 aa AA seqDB search
MKSTAIFLLLMLWNCESARVAESRDDNSVYDLFELVQVPRKNHGVTLVKGDDPYSPAYKI
LNPDLIPPVPESAFRDLIDSIHAEKGFLLLVNFKQFKRTRGSLLTVEKNDGSGPVFEIVS
NGKANTLDIVFSTENKQQVVSIEEADLAVGHWKNITLFVQEDRVQFYVGCEEVNVAELDA
SIHTILTQEIPGVAKMRIGKGAVKDRFMGVLQNVRFVFGTTLEAILRNKGCQNSAMTDII
TLDNPINGSSPAIRTDYTGHKTKDLQMICGFSCEDLAAMFKELKGLGVVVQELSNELRKV
TDDKNMLMNQMGIRAGVCLHNGIVHKNKEEWTVDDCTECTCQNSATVCRKISCPLIPCAN
ATVPDGECCPRCGTPSDSAEDGWSPWSEWTHCSVSCGRGIQQRGRSCDRINNNCEGTSVQ
TRDCYLQECDKRFKQDGSWSHWSPWSSCSVTCGAGVITRIRLCNSPTPQMDGKDCQGEGR
QTERCEKSPCPINGGWGPWSPWDTCSVTCGGGVQNRKRLCNNPVPKHGGKECVGDAKVSQ
ICNKQACPVDGCLSSPCFEGAQCTSFPDGSWKCGKCPTGYTGNGINCKDVNECKEVPDAC
FEFNGVHRCENTVPGYNCLPCPTRYTGPQPFGRGVEDAAAKKQVCTPRNPCLDGSHDCNK
NARCNYLGHFSDPMFRCECKPGFAGNGHICGEDTDLDGWPNADLVCVENATYHCKKDNCP
NLPNSGQEDYDKDGIGDACDDDDDDDGIPDDRDNCPLVFNPRQYDYDRDDVGDRCDNCPY
NSNPDQTDTDNNGEGDACAVDIDGDGILNEKDNCPYLYNVDQKDTDLDGVGDQCDNCPLE
HNPDQLDSDSDRVGDKCDSNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDYDDD
NDGIPDEKDNCRLVFNPDQLDSDGDGRGDACKDDFDMDNVLDIYDVCPENFDISETDFRK
FQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGFDEFNSVDFSGTFFINTERD
DDYAGFVFGYQSSSRFYVVMWKQITQTYWSSTPTKAQGYSGLSIKVVNSTTGPGEHLRNA
LWHTGDTPGQVRTLWHDPKNVGWKDFTAYRWHLTHRPRTGHIRVVMYEGKKIMADSGRIY
DKTYAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3516 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcaactgcaatctttttgctactgatgctttggaactgcgagagcgcgagagtc
gcagagagtcgagacgacaacagtgtttacgatctgttcgagctggtccaagtaccaagg
aaaaaccacggagtgaccctggtgaaaggcgacgacccgtacagccccgcctacaagatc
ctgaaccccgacctgatccccccggtccccgagagcgcctttagggacctaatcgattcc
attcacgccgagaaaggatttctgctgctggttaatttcaagcagttcaaacgcacgagg
ggaagcctgctgactgtggagaagaatgacggttctggacccgtgtttgaaatcgtttcc
aacgggaaagccaacactctggacattgttttttccaccgagaacaagcagcaggtcgtg
tccatcgaggaagcggacttggcggtgggacactggaaaaacatcactcttttcgtgcaa
gaggacagggttcagttctatgtgggatgtgaggaggtgaacgtggcggagctcgatgcc
tcaatccacaccatcctgactcaggagattccaggtgtggccaaaatgaggatcggtaaa
ggcgcggtgaaggacaggttcatgggggtgttgcaaaacgtgcgctttgtattcggaacc
acgctggaagccatcctgaggaataaagggtgccaaaactcagcaatgactgatatcatt
acccttgacaatcccataaatggatccagccctgcaatcaggacagattacactggccac
aaaacaaaagatctgcaaatgatttgtggcttttcatgtgaggatctggctgccatgttt
aaggaactgaaaggtcttggtgtggtggttcaagaactgtccaatgaactccgaaaagtg
acggatgacaaaaacatgctcatgaatcaaatgggcattcgtgctggtgtatgtcttcac
aatggaattgtgcacaaaaacaaggaggaatggacagtggacgactgcacagagtgcact
tgccagaattctgcaacggtgtgccgcaagatttcatgtcccctaatcccatgtgcaaat
gccacagtacctgatggagagtgctgccctcgctgtggaacaccgagcgactccgccgag
gatggttggtccccctggtctgaatggacccattgttcagtgtcctgtggaaggggcatt
cagcagcgcggccgttcctgcgaccgcatcaataacaactgtgagggcacgtcagtgcag
accagagactgctacctccaggagtgcgacaagcgctttaagcaagacggtagctggagc
cactggtcaccctggtcatcgtgttcggtcacatgtggtgctggtgttattacacgcatc
cgtctctgtaactccccgacacctcaaatggatggcaaagactgccagggtgaagggcgg
caaactgagaggtgtgagaaatcaccatgtccgatcaacggtggctggggaccatggtcg
ccctgggatacttgctctgttacctgtggtggtggcgtccaaaaccgtaagcgtctttgc
aataatcctgtacccaaacatggtggcaaagagtgtgtgggagatgcaaaggtcagccag
atttgcaacaaacaagcctgtcctgttgatggatgtctttcgagtccgtgctttgaaggg
gcccagtgcacaagctttccagatgggtcctggaaatgtggaaaatgccccacaggatac
actggcaatggaatcaactgcaaagatgtcaatgagtgtaaggaagtaccagatgcctgc
tttgaatttaatggagtccacagatgtgagaacacagtgccaggctacaactgtctccct
tgccccactcgttacaccgggccacagccgtttggccgtggagtggaggacgccgctgct
aagaagcaggtgtgcactcctcgaaatccctgcctggatggaagccacgactgcaataaa
aacgctcgctgcaactacctgggccatttctctgaccccatgttccgctgtgaatgcaaa
cctggctttgctggaaatggacacatctgtggagaagatactgatcttgatggttggccg
aatgctgatctcgtgtgtgttgagaacgcaacctatcactgcaagaaggacaactgccca
aatcttcccaactcagggcaagaagactatgacaaggatggcattggtgatgcatgtgac
gatgatgatgatgacgatggcattcctgatgacagggataactgcccactcgtcttcaac
ccgagacagtacgactatgatcgggatgatgttggtgaccgttgtgataactgtccctac
aacagcaacccagaccagacagacactgacaacaatggagaaggagacgcctgtgctgtg
gacattgatggagatggtattctgaacgagaaagacaactgtccgtatctgtacaacgtc
gaccagaaagacactgatcttgatggagttggagaccagtgtgacaactgtccattggaa
cacaacccagatcagctggactctgattctgaccgcgttggagacaaatgtgacagtaac
caggatatcgatgaagacggtcaccagaacaacctggacaactgtccatacatccccaat
gccaaccaggctgatcatgacaaggacggtaaaggagatgcctgcgactacgatgatgat
aatgatggcattcctgacgaaaaagacaactgcagactggtcttcaatccagatcagcta
gattctgatggcgatggacgtggcgatgcctgtaaagatgactttgacatggacaatgtt
ctggatatctatgatgtctgtcctgagaacttcgatatcagtgaaaccgacttccgcaag
ttccagatggttcctctggatcccaagggcacttctcagatcgatcccaactgggtggtt
cgtcatcaaggaaaagagctggttcagacagtcaactgcgaccctggcattgctgttggt
tttgatgagttcaattcagtggacttcagtggaacattcttcatcaacactgagagggat
gacgactatgctggttttgttttcggataccagtccagctctcgcttctatgtggtcatg
tggaagcagatcacacagacctactggtccagcacacctaccaaagcacagggttactca
gggctgtccatcaaagtggttaattccaccacaggacctggggagcatctgagaaacgcc
ctttggcacactggagacacaccaggacaggtgcgcacattgtggcatgacccaaagaat
gtgggatggaaggactttactgcttacagatggcacctgacacacagaccaagaactgga
cacataagagtggtcatgtatgaaggcaaaaagatcatggcagattctggcagaatctac
gacaaaacatacgcaggcggaagactaggtctcttcgtcttctcacaagagatggtgtat
ttctcagacctcaaatacgaatgcagagatgcgtaa

DBGET integrated database retrieval system