KEGG   Danio rerio (zebrafish): 561901Help
Entry
561901            CDS       T01004                                 

Gene name
thbs1, Tsp-1, si:dkey-11e23.1, wu:fc48c03
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
dre  Danio rerio (zebrafish)
Pathway
p53 signaling pathway
Phagosome
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:dre04350]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:dre04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:dre04145]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:dre04115]
Cellular Processes; Cell communication; Focal adhesion [PATH:dre04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 1171 aa AA seqDB search
MKSTAIFLLLMLWNCESARVAESRDDNSVYDLFELVQVPRKNHGVTLVKGDDPYSPAYKI
LNPDLIPPVPESAFRDLIDSIHAEKGFLLLVNFKQFKRTRGSLLTVEKNDGSGPVFEIVS
NGKANTLDIVFSTENKQQVVSIEEADLAVGHWKNITLFVQEDRVQFYVGCEEVNVAELDA
SIHTILTQEIPGVAKMRIGKGAVKDRFMGVLQNVRFVFGTTLEAILRNKGCQNSAMTDII
TLDNPINGSSPAIRTDYTGHKTKDLQMICGFSCEDLAAMFKELKGLGVVVQELSNELRKV
TDDKNMLMNQMGIRAGVCLHNGIVHKNKEEWTVDDCTECTCQNSATVCRKISCPLIPCAN
ATVPDGECCPRCGTPSDSAEDGWSPWSEWTHCSVSCGRGIQQRGRSCDRINNNCEGTSVQ
TRDCYLQECDKRFKQDGSWSHWSPWSSCSVTCGAGVITRIRLCNSPTPQMDGKDCQGEGR
QTERCEKSPCPINGGWGPWSPWDTCSVTCGGGVQNRKRLCNNPVPKHGGKECVGDAKVSQ
ICNKQACPVDGCLSSPCFEGAQCTSFPDGSWKCGKCPTGYTGNGINCKDVNECKEVPDAC
FEFNGVHRCENTVPGYNCLPCPTRYTGPQPFGRGVEDAAAKKQVCTPRNPCLDGSHDCNK
NARCNYLGHFSDPMFRCECKPGFAGNGHICGEDTDLDGWPNADLVCVENATYHCKKDNCP
NLPNSGQEDYDKDGIGDACDDDDDDDGIPDDRDNCPLVFNPRQYDYDRDDVGDRCDNCPY
NSNPDQTDTDNNGEGDACAVDIDGDGILNEKDNCPYLYNVDQKDTDLDGVGDQCDNCPLE
HNPDQLDSDSDRVGDKCDSNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDYDDD
NDGIPDEKDNCRLVFNPDQLDSDGDGRGDACKDDFDMDNVLDIYDVCPENFDISETDFRK
FQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGFDEFNSVDFSGTFFINTERD
DDYAGFVFGYQSSSRFYVVMWKQITQTYWSSTPTKAQGYSGLSIKVVNSTTGPGEHLRNA
LWHTGDTPGQVRTLWHDPKNVGWKDFTAYRWHLTHRPRTGHIRVVMYEGKKIMADSGRIY
DKTYAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3516 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcaactgcaatctttttgctactgatgctttggaactgcgagagcgcgagagtc
gcagagagtcgagacgacaacagtgtttacgatctgttcgagctggtccaagtaccaagg
aaaaaccacggagtgaccctggtgaaaggcgacgacccgtacagccccgcctacaagatc
ctgaaccccgacctgatccccccggtccccgagagcgcctttagggacctaatcgattcc
attcacgccgagaaaggatttctgctgctggttaatttcaagcagttcaaacgcacgagg
ggaagcctgctgactgtggagaagaatgacggttctggacccgtgtttgaaatcgtttcc
aacgggaaagccaacactctggacattgttttttccaccgagaacaagcagcaggtcgtg
tccatcgaggaagcggacttggcggtgggacactggaaaaacatcactcttttcgtgcaa
gaggacagggttcagttctatgtgggatgtgaggaggtgaacgtggcggagctcgatgcc
tcaatccacaccatcctgactcaggagattccaggtgtggccaaaatgaggatcggtaaa
ggcgcggtgaaggacaggttcatgggggtgttgcaaaacgtgcgctttgtattcggaacc
acgctggaagccatcctgaggaataaagggtgccaaaactcagcaatgactgatatcatt
acccttgacaatcccataaatggatccagccctgcaatcaggacagattacactggccac
aaaacaaaagatctgcaaatgatttgtggcttttcatgtgaggatctggctgccatgttt
aaggaactgaaaggtcttggtgtggtggttcaagaactgtccaatgaactccgaaaagtg
acggatgacaaaaacatgctcatgaatcaaatgggcattcgtgctggtgtatgtcttcac
aatggaattgtgcacaaaaacaaggaggaatggacagtggacgactgcacagagtgcact
tgccagaattctgcaacggtgtgccgcaagatttcatgtcccctaatcccatgtgcaaat
gccacagtacctgatggagagtgctgccctcgctgtggaacaccgagcgactccgccgag
gatggttggtccccctggtctgaatggacccattgttcagtgtcctgtggaaggggcatt
cagcagcgcggccgttcctgcgaccgcatcaataacaactgtgagggcacgtcagtgcag
accagagactgctacctccaggagtgcgacaagcgctttaagcaagacggtagctggagc
cactggtcaccctggtcatcgtgttcggtcacatgtggtgctggtgttattacacgcatc
cgtctctgtaactccccgacacctcaaatggatggcaaagactgccagggtgaagggcgg
caaactgagaggtgtgagaaatcaccatgtccgatcaacggtggctggggaccatggtcg
ccctgggatacttgctctgttacctgtggtggtggcgtccaaaaccgtaagcgtctttgc
aataatcctgtacccaaacatggtggcaaagagtgtgtgggagatgcaaaggtcagccag
atttgcaacaaacaagcctgtcctgttgatggatgtctttcgagtccgtgctttgaaggg
gcccagtgcacaagctttccagatgggtcctggaaatgtggaaaatgccccacaggatac
actggcaatggaatcaactgcaaagatgtcaatgagtgtaaggaagtaccagatgcctgc
tttgaatttaatggagtccacagatgtgagaacacagtgccaggctacaactgtctccct
tgccccactcgttacaccgggccacagccgtttggccgtggagtggaggacgccgctgct
aagaagcaggtgtgcactcctcgaaatccctgcctggatggaagccacgactgcaataaa
aacgctcgctgcaactacctgggccatttctctgaccccatgttccgctgtgaatgcaaa
cctggctttgctggaaatggacacatctgtggagaagatactgatcttgatggttggccg
aatgctgatctcgtgtgtgttgagaacgcaacctatcactgcaagaaggacaactgccca
aatcttcccaactcagggcaagaagactatgacaaggatggcattggtgatgcatgtgac
gatgatgatgatgacgatggcattcctgatgacagggataactgcccactcgtcttcaac
ccgagacagtacgactatgatcgggatgatgttggtgaccgttgtgataactgtccctac
aacagcaacccagaccagacagacactgacaacaatggagaaggagacgcctgtgctgtg
gacattgatggagatggtattctgaacgagaaagacaactgtccgtatctgtacaacgtc
gaccagaaagacactgatcttgatggagttggagaccagtgtgacaactgtccattggaa
cacaacccagatcagctggactctgattctgaccgcgttggagacaaatgtgacagtaac
caggatatcgatgaagacggtcaccagaacaacctggacaactgtccatacatccccaat
gccaaccaggctgatcatgacaaggacggtaaaggagatgcctgcgactacgatgatgat
aatgatggcattcctgacgaaaaagacaactgcagactggtcttcaatccagatcagcta
gattctgatggcgatggacgtggcgatgcctgtaaagatgactttgacatggacaatgtt
ctggatatctatgatgtctgtcctgagaacttcgatatcagtgaaaccgacttccgcaag
ttccagatggttcctctggatcccaagggcacttctcagatcgatcccaactgggtggtt
cgtcatcaaggaaaagagctggttcagacagtcaactgcgaccctggcattgctgttggt
tttgatgagttcaattcagtggacttcagtggaacattcttcatcaacactgagagggat
gacgactatgctggttttgttttcggataccagtccagctctcgcttctatgtggtcatg
tggaagcagatcacacagacctactggtccagcacacctaccaaagcacagggttactca
gggctgtccatcaaagtggttaattccaccacaggacctggggagcatctgagaaacgcc
ctttggcacactggagacacaccaggacaggtgcgcacattgtggcatgacccaaagaat
gtgggatggaaggactttactgcttacagatggcacctgacacacagaccaagaactgga
cacataagagtggtcatgtatgaaggcaaaaagatcatggcagattctggcagaatctac
gacaaaacatacgcaggcggaagactaggtctcttcgtcttctcacaagagatggtgtat
ttctcagacctcaaatacgaatgcagagatgcgtaa

DBGET integrated database retrieval system