KEGG   Danio rerio (zebrafish): 561941Help
Entry
561941            CDS       T01004                                 

Gene name
prkx, si:dkeyp-86f8.3
Definition
(RefSeq) protein kinase, X-linked
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     561941 (prkx)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   561941 (prkx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
1
AA seq 357 aa AA seqDB search
MASTKGKAGINNESSSGRDSGRTEAGSPTLPAGAASLTTNRTYTLDDLDTIATVGTGTFG
RVFLVKDKKTRGFFALKAMKIPDVIRLKQEQHVHNEKEVLTEVNHPFLVRLFWTHHDDRF
LYMLMEYVNGGELFSYLRSRGHFSNSTGMFYSAEIVCAIEYLHSKEIVYRDLKPENILLD
SEGHIRLTDFGFAKKLSERTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGVLIFEMLAGY
PPFFDDNPFGIYQKILAGKLEFPRHLDLYVKDLIKKFLVTDRERRLGNMKNGADDVKKHR
WFKSVNWESVPCRKLKPPIVPKVSHEGDTSNFDSYPDEEWKKDTPVPAKDLEIFKNF
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaactaaaggaaaagctggaataaataatgaaagcagttctggtcgggatagt
ggcaggacagaagctggcagccccacgttacccgcaggggccgcatccctgaccaccaac
cggacctacacactagatgacctggatacaattgccaccgttggtacaggaacttttggg
agggtgtttctggtgaaggataaaaagactagaggattctttgctctgaaggcaatgaag
atccctgatgtcattcgtctaaagcaggagcagcacgtacataatgaaaaagaggttttg
acggaggtgaaccatcctttccttgtcagactgttctggacgcaccatgatgatcgcttc
ctctacatgttgatggaatatgtgaatggcggtgaactcttcagctatttacgcagccga
ggacatttcagtaacagtacgggaatgttttattcagctgaaatcgtgtgcgccattgaa
taccttcactccaaagaaatcgtctacagagacctgaagccagagaatatattgctggac
agtgaggggcacattcgactgacagatttcgggtttgctaaaaagctctccgaaaggaca
tggactctgtgcggcactcctgagtatttggctccagaggtgattcagagtaaaggtcat
gggcgagctgtggactggtgggctctgggtgtgctcatctttgaaatgctggcaggatat
ccacccttttttgatgataatccctttggcatctaccagaagattctggccggaaagctg
gagtttcctcggcatctggatttatatgtaaaggatctaataaagaagtttctcgtgact
gaccgggaaagaaggcttggaaacatgaagaatggagccgatgatgtgaaaaagcacaga
tggtttaagtcagtaaactgggagtctgtaccctgtagaaagctgaagccacccatagtt
ccaaaggtgtcccacgagggagacacatccaactttgactcctatccagatgaggagtgg
aagaaggacacaccggtaccagcgaaagatctggaaatttttaagaacttctaa

DBGET integrated database retrieval system