KEGG   Danio rerio (zebrafish): 561941Help
Entry
561941            CDS       T01004                                 

Gene name
prkx
Definition
(RefSeq) protein kinase, X-linked
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    561941 (prkx)
   04310 Wnt signaling pathway
    561941 (prkx)
   04340 Hedgehog signaling pathway
    561941 (prkx)
   04020 Calcium signaling pathway
    561941 (prkx)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    561941 (prkx)
   04210 Apoptosis
    561941 (prkx)
  Cellular commiunity
   04540 Gap junction
    561941 (prkx)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    561941 (prkx)
   04912 GnRH signaling pathway
    561941 (prkx)
   04914 Progesterone-mediated oocyte maturation
    561941 (prkx)
   04916 Melanogenesis
    561941 (prkx)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    561941 (prkx)
   04270 Vascular smooth muscle contraction
    561941 (prkx)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     561941 (prkx)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   561941 (prkx)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     561941 (prkx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 357 aa AA seqDB search
MASTKGKAGINNESSSGRDSGRTEAGSPTLPAGAASLTTNRTYTLDDLDTIATVGTGTFG
RVFLVKDKKTRGFFALKAMKIPDVIRLKQEQHVHNEKEVLTEVNHPFLVRLFWTHHDDRF
LYMLMEYVNGGELFSYLRSRGHFSNSTGMFYSAEIVCAIEYLHSKEIVYRDLKPENILLD
SEGHIRLTDFGFAKKLSERTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGVLIFEMLAGY
PPFFDDNPFGIYQKILAGKLEFPRHLDLYVKDLIKKFLVTDRERRLGNMKNGADDVKKHR
WFKSVNWESVPCRKLKPPIVPKVSHEGDTSNFDSYPDEEWKKDTPVPAKDLEIFKNF
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaactaaaggaaaagctggaataaataatgaaagcagttctggtcgggatagt
ggcaggacagaagctggcagccccacgttacccgcaggggccgcatccctgaccaccaac
cggacctacacactagatgacctggatacaattgccaccgttggtacaggaacttttggg
agggtgtttctggtgaaggataaaaagactagaggattctttgctctgaaggcaatgaag
atccctgatgtcattcgtctaaagcaggagcagcacgtacataatgaaaaagaggttttg
acggaggtgaaccatcctttccttgtcagactgttctggacgcaccatgatgatcgcttc
ctctacatgttgatggaatatgtgaatggcggtgaactcttcagctatttacgcagccga
ggacatttcagtaacagtacgggaatgttttattcagctgaaatcgtgtgcgccattgaa
taccttcactccaaagaaatcgtctacagagacctgaagccagagaatatattgctggac
agtgaggggcacattcgactgacagatttcgggtttgctaaaaagctctccgaaaggaca
tggactctgtgcggcactcctgagtatttggctccagaggtgattcagagtaaaggtcat
gggcgagctgtggactggtgggctctgggtgtgctcatctttgaaatgctggcaggatat
ccacccttttttgatgataatccctttggcatctaccagaagattctggccggaaagctg
gagtttcctcggcatctggatttatatgtaaaggatctaataaagaagtttctcgtgact
gaccgggaaagaaggcttggaaacatgaagaatggagccgatgatgtgaaaaagcacaga
tggtttaagtcagtaaactgggagtctgtaccctgtagaaagctgaagccacccatagtt
ccaaaggtgtcccacgagggagacacatccaactttgactcctatccagatgaggagtgg
aagaaggacacaccggtaccagcgaaagatctggaaatttttaagaacttctaa

DBGET integrated database retrieval system