KEGG   Danio rerio (zebrafish): 561967Help
Entry
561967            CDS       T01004                                 

Gene name
wu:fb62a02
Definition
si:ch211-93f2.1
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
dre  Danio rerio (zebrafish)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    561967 (wu:fb62a02)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     561967 (wu:fb62a02)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     561967 (wu:fb62a02)
    3.1.1.84  cocaine esterase
     561967 (wu:fb62a02)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Position
25
AA seq 1611 aa AA seqDB search
MAMRESAVLSLCILIAVTLQNSVKAEDGPILQTNSGALKGLQMKARGKDTVIHSYLGIPF
AKPPVGPLRLAPPQPAEKWEGVRDATKQPLMCLQDRQLVEDLVANLSAKVDMVDSSEDCL
YLNVYTPSKPGRNDKLPVMVWIHGGGFTTCSASLFDGHVLAAYQDVVVVVIQYRLGLLGF
FSTGDENAPGNYGLLDQVAALQWVQENIHSFGGDPGSVTIFGESAGGISVSLHVLSPLSA
NLFHRAIAESGTAAMEAIMNVNPLPIAQAIGNASGCDISSTKKIVDCLMQKSEVEILKIT
MENPLFRFGVTIDGQFLPRPAAELFQSQQFNKVPLMTGVTDDEIGFVLPNYLLPPDWING
LDLESILPLLTVFNPALQDQSVLELLLNEYLGTSPDRIRIRDGFREMLGDFMFNIPARQT
ASYHRDAGAPVYVYEFRHPPSVLQRKRPSFSGSDHGDEIVFVFGYCFSEGPIGMAENLSD
EEDELCRTTMAYWGNFAHTGNPNGPGLTSWPEFGDEAEYLSIGLDPKASTDLKGKHFTFV
TQTFPRILSERKEGPVVNTKLGSLRGSYMMAKGKDSVISSYFAIPFAKSPVGPLRLTPPQ
PADAWQGVRDATKQPPMCLQPKEVMVDLLATMPLKTEFPEVSEDCLYLNIYTPSKPGDNK
KLPVMVWIHGGGLAFGSASIFDAHALAAYQDIVVVMVQYRLGLLGFFSTGDEHAPGNYGL
LDQVAALQWVQENIHSFGGDPGSVTVFGESAGGVSASLLVLSPLSANLFHRAIAESGTAA
MNAIMSPDPLSTARSLGNVSGCDISSTKKIVDCVMQMTEEDILKIAREQVLLRFGVTVDG
QFLPKSVDELLQSQEFSKVPLMTGVTDDDGGFTLPEFIAPPGWRDGMTKDQIMPFLPTYN
YDLQDPGLAEIVLKEYLGATTDKIKIRDGFREIVGDFFFNLPARKLANYHRDTGAPVYMY
EFQHPAYIFQNKRPSFVGCDHGDELLFVFGYCFGNGHIKVEGELSKEEQELCKTTMAYWG
NFARTGNPNGPGLVEWPKYGAEAEYLGIGLEQKSSKNFKGNHFHFMIEKLPQIIKEWKEG
PVVETKLGSLRGAFLTVKGKDTIVNSYLGVPFAKPPVGPLRLARPQAAEKWQGVRDATKQ
PRMCLQERQMTVTELEFLSMDVEVPEVSEDCLYLNIYTPVKPGQGDKKLPVMVWIHGGGL
SLGSASMYDGSVLAAYQDVVVVLIQYRLGLLGFLSTGDEHAPGNYGFLDQVAALQWVQEN
IHSFGGDPGSVTIFGESAGGISVSTLILSPLASGLFHRAIAESGTAFWDGLVMADPFQRA
QTAAKQCNCDSSSSAKIVDCIMHWSEEEALECAKKFQMMHFSVAVDSYFLPKPIEEIVEK
QEFSKVPLINGINNDEFGFLLAEYFLGPEWMNGLKREQIAEALTLTYPDPKDRWIIDLVA
KEYLGDTHDPIEIREVYREMMGDVLFNIPALQLAKHHSGTGAPVYLYELQHPPSFLQKKR
PSFVGVDHADDLYFIQGTCFAKAHLRISAPFTEEENELCRTVMAYWGNFAHTGSPNGPGL
THWPEYENENEYLAIGLQQKPGKNLKHKHYEFMTKTLPELIRQGKTKHSEL
NT seq 4836 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgagggaatccgccgtgctttcactctgcatcctgatcgcagtgactttacaa
aacagcgtcaaagcggaggatggacctatcttgcaaaccaattctggagccctgaaaggt
ctacaaatgaaagcaaggggaaaagacaccgttatccattcgtacttgggcatccccttt
gccaagccacccgtgggtccactaagactggctccaccacaaccagctgagaaatgggaa
ggagtgagagacgctacaaaacagccgttaatgtgtctgcaggataggcagttagttgaa
gacttggtagccaatttatcggcaaaagtagacatggtggattcatcagaagactgcctt
tacctcaatgtatacacaccgtctaaacctggaagaaacgacaagctgcctgttatggtg
tggatccatggcggaggtttcacgacttgttcggcatccttgtttgacggacatgttttg
gctgcttatcaggacgttgttgtggtcgtgatacaatacagactcggcctgcttggattt
ttcagcactggagacgagaatgctccaggaaactatggtcttctggatcaggtagctgcg
ctacagtgggttcaggagaacatccacagcttcggcggagatcctggatcagtgaccatc
tttggagagtctgctggaggaatcagtgtgtctttacatgttctgtctcctttgtctgca
aacctcttccatcgtgctattgcagagagcggtacagctgcaatggaggctataatgaat
gtcaacccacttcccatcgctcaggctataggaaatgcatctggctgtgatatttccagc
acaaaaaagattgtcgactgtctgatgcagaagtcagaagtggagatactgaagattaca
atggagaatcctctgtttcgttttggagtgacgatcgatggccagtttcttccaagacct
gcagcagagctttttcagtcgcagcagtttaacaaagtgcctctgatgaccggagtcact
gatgatgagattggatttgtgctgcccaattaccttttacctccagattggatcaatggg
ctcgacctggagtcaatcttgccacttttgactgtgttcaatcctgctcttcaagatcag
tcagttcttgagcttcttttaaatgagtatctgggcacatcccctgacaggatcagaatt
cgagatggttttcgagaaatgttaggagacttcatgttcaacatcccagctcgacaaacg
gcaagttaccacagagatgcgggcgcaccggtgtacgtgtatgaattccgtcatcccccc
agtgtacttcagaggaaaagacccagtttttctggaagtgaccatggagatgaaattgtg
ttcgttttcggctactgcttttcagaaggacccatagggatggcagagaatctctcagat
gaagaagatgaactctgcagaaccaccatggcttactggggaaactttgctcatacaggg
aatccaaatggtccaggtctcacatcgtggcctgagtttggagatgaagccgaatatctc
agtattggtctggatccgaaagccagcactgacctgaagggaaaacacttcactttcgtg
acccaaacttttccaaggatattaagtgagcgaaaggaaggacctgtagtaaacactaaa
ttaggatctctaagaggttcctacatgatggcgaaggggaaggactctgtcatcagtagc
tattttgctataccctttgctaagtctccggtgggtcctttgaggttgactccaccacag
cctgcagacgcatggcaaggagtaagagatgccaccaagcagccgcccatgtgtctccag
ccaaaggaggttatggttgacttgctagctacaatgccattgaaaacggagttcccagaa
gtgtcagaggactgtctttacctcaacatttacactccttccaaacctggagacaacaaa
aagttacctgtcatggtctggattcatggcggaggtttagcttttggatctgcttccatt
tttgacgcacatgctttggctgcttatcaagacatagtggtggtcatggtccagtacaga
cttggcctgcttggatttttcagcaccggagatgagcatgctccaggaaactatggtctt
ctggatcaggtagctgcgcttcagtgggttcaggagaacatccacagcttcggtggagat
cctggatcagtgaccgtctttggagagtctgctggaggagtcagtgcgtctttacttgtt
ctttccccgttatctgctaacctgtttcatcgtgcaatcgcagagagcggtacggcagca
atgaacgctataatgagtcccgacccactgtcaacagcccgatctttaggaaacgtgtct
ggctgtgatatttccagcacaaagaagattgttgactgtgttatgcagatgaccgaagag
gacatattgaagattgccagggagcaggtattgcttcgttttggagtgaccgttgatggg
cagttccttccgaaatctgtggatgagcttcttcagtctcaagagtttagcaaagtgcct
ttgatgactggagttactgatgatgatggtggattcactctacctgaattcattgcaccc
ccaggatggagagatggaatgaccaaagatcagatcatgccatttttgcctacatataat
tatgatcttcaggatccaggacttgctgagattgttttaaaagaatatctgggcgcaacc
actgacaagatcaaaatccgagatggttttcgagaaatagtgggggacttctttttcaac
ctcccagctcgcaaattagcgaattaccacagagatactggtgcaccagtgtacatgtat
gaattccagcatcctgcctatatatttcaaaacaaaagacccagctttgttggatgtgat
catggagatgaacttttatttgtttttggttattgctttggaaatggacacataaaggtg
gaaggtgaactctcaaaggaagaacaagaactttgtaaaactaccatggcttactgggga
aactttgctcgcactgggaatccgaatggtccaggccttgtagagtggccaaaatatgga
gctgaagccgagtatcttggtattggactggaacagaaatccagcaaaaactttaaggga
aatcactttcatttcatgatcgaaaaactcccgcagatcataaaagagtggaaggaagga
cctgtagtagaaacaaaactaggatctctgagaggtgccttcttgactgtgaagggcaag
gacacaatagtcaatagttatctaggtgtgccgttcgccaagccgcctgtaggacccctg
agacttgctcgaccacaggctgcagagaaatggcaaggagttagagatgccaccaaacag
ccacggatgtgcctccaggaaaggcaaatgactgtaactgaactggagtttctatcgatg
gatgtggaggttcctgaggtctcggaggattgcctgtatcttaacatctacaccccagtt
aaacctggacaaggagacaagaagttaccagtcatggtttggattcatggtggaggactc
tctcttggatcggcttcaatgtatgatggctctgttctggctgcgtatcaggatgtggtc
gtggtgctcattcagtacagattgggtcttctggggttcttaagcaccggagacgagcat
gcgccaggaaactatggttttctggatcaagtagctgcccttcagtgggttcaggagaac
atccacagcttcggtggagatcctggatcagtgaccatctttggagagtctgctggagga
atcagtgtatccacgctgattctttccccgctggcgtctggactgtttcatcgcgccatt
gcagaaagtggaactgccttctgggatggtttagtcatggctgatccttttcagagagcc
cagactgcagccaaacaatgcaactgtgacagcagcagttcagcaaagattgtcgactgc
attatgcactggtctgaagaggaggctctggaatgtgctaaaaagttccagatgatgcac
ttctccgttgctgtagattcttatttccttcccaaacccatcgaggagattgttgagaaa
caagagtttagtaaagttcctctcatcaacggcattaacaatgatgagtttggcttcttg
ttggctgaatatttcttgggtcctgaatggatgaatgggttgaaaagagagcaaatcgct
gaagccttgacgctcacatatcctgatcccaaggatcgatggatcattgatctggtggcg
aaggaatatctgggcgacacacacgaccccattgaaatccgtgaagtttatcgggagatg
atgggagacgtgctgtttaacatccctgccctgcaactggcaaaacaccacagcggcaca
ggagctccagtgtacctgtatgagctccagcatccgcccagcttcctccagaagaagagg
cctagcttcgtgggtgtggaccacgctgatgacctctacttcatccagggcacctgcttc
gctaaagcccatctcagaataagcgctcctttcacagaagaagaaaacgagctctgcagg
actgtgatggcctactgggggaactttgcacacactgggtctcccaatggtccgggtctg
acacattggccagaatatgaaaatgagaatgagtatcttgccatcggactgcaacagaaa
cctgggaaaaaccttaagcacaaacactatgagttcatgaccaagactcttccagaactc
atacgtcaaggaaaaaccaagcactcagaactgtaa

DBGET integrated database retrieval system