KEGG   Danio rerio (zebrafish): 562139Help
Entry
562139            CDS       T01004                                 

Definition
chymotrypsinogen 2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     562139
Peptidases [BR:dre01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   562139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 263 aa AA seqDB search
MAFVWILSCLALIGTAYGCGVPAIPPVITGYARIVNGEEAVPHSWPWQVSLQDSTGFHFC
GGSLINEWWVVTAAHCNVRTSHRVILGEHDRSSNAEPIQTMTVGKVFKHPNFNMFTINND
ILLIKLATPAKINTHVSPVCLAETNDNFPGGMKCVTSGWGLTKHNAPDTPALLQQAALPL
LTNEDCKRFWGNKITDLMVCAGASGASSCMGDSGGPLVCQKDGVWTLVGIVSWGSSVCST
SSPGVYARVTKLRAWVDQTITAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgtctggattttgtcgtgccttgccttgattggaacagcatatggctgtggc
gttcctgccatccctcctgttattaccggttatgccaggattgtaaacggtgaggaggct
gtccctcattcctggccctggcaggtgtctctgcaggactccaccggcttccacttctgc
ggaggctccctgatcaacgagtggtgggttgtgactgctgctcactgcaacgtcaggacc
tctcaccgtgtcatcctgggtgagcatgatcgttcctccaatgctgagcccattcagacc
atgaccgttggaaaggttttcaagcatcctaatttcaacatgttcaccatcaacaatgac
atcctgctgatcaagctggccactcctgctaagatcaacactcatgtgtctcctgtgtgt
ctcgccgagaccaacgacaacttccctggtggcatgaagtgtgtgacctccggatggggc
ctgaccaaacacaatgctcctgatacccctgccctgctccagcaggccgctctgcctctg
ctgaccaatgaagactgcaaacgcttctggggaaacaaaatcactgatctaatggtctgt
gctggagcatctggtgcttcttcctgcatgggtgactctggtggtcctctggtgtgtcag
aaagatggagtctggactctggttggtatcgtgtcctggggtagcagcgtttgctccacc
agttctcccggtgtttacgcccgcgtcaccaagctccgtgcctgggttgaccagaccatc
actgcaaactaa

DBGET integrated database retrieval system