KEGG   Danio rerio (zebrafish): 562139Help
Entry
562139            CDS       T01004                                 

Definition
chymotrypsinogen 2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 263 aa AA seqDB search
MAFVWILSCLALIGTAYGCGVPAIPPVITGYARIVNGEEAVPHSWPWQVSLQDSTGFHFC
GGSLINEWWVVTAAHCNVRTSHRVILGEHDRSSNAEPIQTMTVGKVFKHPNFNMFTINND
ILLIKLATPAKINTHVSPVCLAETNDNFPGGMKCVTSGWGLTKHNAPDTPALLQQAALPL
LTNEDCKRFWGNKITDLMVCAGASGASSCMGDSGGPLVCQKDGVWTLVGIVSWGSSVCST
SSPGVYARVTKLRAWVDQTITAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgtctggattttgtcgtgccttgccttgattggaacagcatatggctgtggc
gttcctgccatccctcctgttattaccggttatgccaggattgtaaacggtgaggaggct
gtccctcattcctggccctggcaggtgtctctgcaggactccaccggcttccacttctgc
ggaggctccctgatcaacgagtggtgggttgtgactgctgctcactgcaacgtcaggacc
tctcaccgtgtcatcctgggtgagcatgatcgttcctccaatgctgagcccattcagacc
atgaccgttggaaaggttttcaagcatcctaatttcaacatgttcaccatcaacaatgac
atcctgctgatcaagctggccactcctgctaagatcaacactcatgtgtctcctgtgtgt
ctcgccgagaccaacgacaacttccctggtggcatgaagtgtgtgacctccggatggggc
ctgaccaaacacaatgctcctgatacccctgccctgctccagcaggccgctctgcctctg
ctgaccaatgaagactgcaaacgcttctggggaaacaaaatcactgatctaatggtctgt
gctggagcatctggtgcttcttcctgcatgggtgactctggtggtcctctggtgtgtcag
aaagatggagtctggactctggttggtatcgtgtcctggggtagcagcgtttgctccacc
agttctcccggtgtttacgcccgcgtcaccaagctccgtgcctgggttgaccagaccatc
actgcaaactaa

DBGET integrated database retrieval system