KEGG   Danio rerio (zebrafish): 562529Help
Entry
562529            CDS       T01004                                 

Gene name
flna, fb98b06, wu:fb98b06, wu:fd09g03, wu:fd49a06
Definition
filamin A, alpha (actin binding protein 280)
Orthology
K04437  
filamin
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    562529 (flna)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    562529 (flna)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    562529 (flna)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   562529 (flna)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
23
AA seq 2523 aa AA seqDB search
MSQHTRPHQSSAAAPLSNASLSPDKDADMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKC
VNKRIANLQTDLSDGLRLIALLEVLSQKKMFRKYNQRPTFRQMQLENVSVALEFLDIENI
KLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEESEESKQKTPKQRLLGWIQN
KLPELPITNFSRDWQSGKALGALVDSCAPGLCPDWDSWDQTKPVDNAREAMQQADDWLGV
PQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNVV
MKKAVFTVETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTV
LFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEV
VIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEAC
NPSLCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGV
YSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGSEAGPQQVRAWGPGLESGVVGKSADF
VVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLS
PFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLKIQAQDRDG
NPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSG
PGVAKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTV
KYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFT
VNTKAAGKAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPI
PKSPFAVAIAPSLDLSKVKVAGLGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSV
PCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKVRCSGPG
LERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAY
TLTIRYGDQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTG
GNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPV
TEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGS
CCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDPTKVKCQGQGLGNNVRANIPQV
FSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEI
PQSPYKVKVLPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGK
PKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVS
IGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDI
FYTAPQPGKYVICVRFGGEHIPNSPFQVTATDGQLGMNGLDVAGLRPFDLVIPFTIQKGE
ITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYV
NSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCTDNQDGTCTVS
YLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDDSMRMSHLKVGSAADIPLDIGELDLSQL
TATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSE
IGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCK
VTYCPTEPGNYIINIKFADQHVPGSAFTVKVTGEGRMKESITRKRRAASVANVGSQCDLS
LKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPG
SPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEI
AFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARRLTVASLQES
GLKVNQPASFAVSLNGAKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLID
VKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALA
VTIDGPSKVKMDCQECPEGYKVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKITGSRLVN
SHSMHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCS
KAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYH
ITV
NT seq 7572 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacacacacgcccccaccagtcgagcgccgccgctcccctatccaacgcttct
ctctccccggacaaggacgccgacatgcccgctacagagaaagatctcgccgaggacgcg
ccatggaagaaaatccagcaaaatacattcacgcgttggtgcaacgagcatctgaaatgt
gtcaacaagcgcatagcgaacctgcagacggacctgagcgacgggctccggctgatcgcg
cttctggaggtgctcagccagaagaagatgttccgcaagtacaaccagcgccctaccttc
agacagatgcagctggagaacgtctccgtggcgctggagttcctggacattgaaaacatc
aagctggtctccattgacagtaaggccatagtggatggtaacctgaagctgatcctgggt
ctgatatggactcttattctgcattattccatctccatgcccatgtgggacgaggaagag
gagagcgaggaaagcaagcagaagacgcccaagcagaggctcctcggatggatccagaac
aagctgcccgagctgccaatcaccaacttcagccgcgattggcagtcagggaaagccctt
ggcgctctggtggacagttgtgctccaggtctgtgtccagactgggattcctgggaccag
accaagcctgtggacaatgccagagaggccatgcagcaggctgatgactggctcggtgtt
cctcaggtcatcacaccagaagaaatcgttgatcccaatgtggacgagcactccgttatg
acttacctgtcccagtttcccaaagccaaactcaagcctggtgcccctctgaggcccaaa
ctcaatcccaaaaaggcccgtgcttatggaccaggtattgagccaacaggtaatgttgtg
atgaagaaggctgtgttcactgttgagaccatcagcgctggtcagggtgaggtactggtt
tatgtcgaggaccccgctggacaccgcgaggaggccaaagtcacagccaacaatgacaag
aaccgcacctactcagtattctatgtgccaaaagtcactggacaacacaaggtgacagtg
ctgtttgcagggcaacacatctctaagagcccgtttgaggtggatgtgggaatggctcag
ggagactccagcaaggtcactgcccagggcccaggactcgagcctgcaggcaacattgcc
aacaaaaccacatactttgatgtctacacagctggtgctggagtaggagaggtggaggtg
gtcatcatggaccccagtggaaagaaggacacggttgagtgcagtgtcgaggataaaggc
aacagcagctaccgatgcacctacaagcccactcaggagggacagcacatcatttacatc
acctttgccgggggacagatctccaagagcccttacactgtcaatgtgggagaggcctgt
aatccaagcctgtgtacagccaagggccgcggtctgcagcctaaaggcctgagggtcaag
gagaccgccgagtttaaggtttacaccaaaggagcaggaaccggagacctcaaagttacc
atcaaagggcccaagggtctcgaggagccctgtaagaagaaggatttgggagacggcgtg
tacagctttgattattacccctccacacctggaaattacatcatcaccatcacatggggc
ggtcaacacatcccacgcagcccgtttgaggtgaagatcgggtctgaagcaggaccgcag
caggtcagggcgtggggtccaggactagagagtggcgttgtgggcaaatctgctgacttt
gttgtggaagctgttggtgatgatgtgggcactttaggtttctctgttgaaggcccttcc
ccggctaagattgaatgtgatgataagggagatggttcatgtgacgtgaggtactggccc
accgaaccgggtgaatatgcagttcatgtgctctgtaagaatgaggacatccagctcagc
cctttcatggctgaaatcatgcccgccccaggaaaagacttttatcctgacaaggtgaag
gcttatggccccggtctgcagagctcaggcctgtcagttggcaaaccagccgagtttacc
gtggatgccaaactgggtggcaaagctcctctgaagattcaagctcaggaccgtgatgga
aacccagtcgatgtgcaggtgaaggacaatggaaatgggacatacagctgcagctacacc
cctcgcaaaccagtcaaacacactgtgatggtgtcctggggcggcgtcaacatcccagag
agcccgttcagaatgaacattggggcagggtgtcatcccaataaggtgaaagtatctgga
cctggagtggccaagacaggcctcaaagcatatgatccaacatactttactgtggattgt
gctgaggctggacagggcgacatcagcataggcatcaaatgtgctgcaggtgtggtggga
cctgctgaggctgacatagacttcgacatcattagaaatgacaacgacacatttactgtt
aaatacactcctcctggagcgggcagctacaccatcatggtgctgtttgctgatcagacc
attcccatgacacccatcagaattaaggttgatccctctcatgatgcaagcaaggttaaa
gctgaggggcctggacttagccgttctggtgtggagctgaacaaacccactcacttcact
gtgaacacaaaggctgcaggcaaggccaagcttgatgctcagttcactggacccaacaag
ggagatgcagtccgtgacttcgacataatcgacaaccatgatggcactcacactgtcaaa
tatacccctgtccaacagggcaacatgggtttgaatgtcacctacggtggtgaccctatt
cccaagagcccatttgcagtagcaattgccccctctctggacctcagtaaagttaaagtg
gctggtcttggaagtaaaatgactgttggaaaggatcaggagatcacagtcaaatctaaa
ggtgcaggcggtcagggcaaagttggcgcaaaggttactggtccatctgctaaatcagtg
ccctgtaaagttgaaccaggcctgagcccagaaaccagccaagttcgttttatcccaaga
gataagggaccctatgaggtggaactgacatatgatggcgcccccatccctggcagtcca
ttccccatcgaagccattgcacctactgacccatccaaggtgcgatgctctgggccagga
ctggagcgggcgaaggttggcgagcctggacagtttgtggtggattgcactaatgctggc
cctgctgagttgaccatcgagatcatctctgacaatggcactgaggctgaagtccacatt
caagacaacggcgacgggacctacaccatcacttacgtccctctctaccctggagcctat
accctcaccatccgctacggggaccaggatgtgccaaacttcccagcaagactccatgtg
gagcctgctgtggagaccagtggagtgaaagtgttcggacccggagtggagggcaaaggt
gttttcagggaagccactacagatttcactgtggatgcccgtgcgctcactaaaaccgga
ggcaatcacatcaaaacctgcatcaacaacccatcgggcaaccgcactgaagcactgatc
cgagatctgggagacggcacatatcaagtggagtacacgccttatgaggagggtacacac
agtgttgaggttgcatatgacagctccccggttcccaaaagccccttccgtgtgccagtg
accgagggctgtgacccggcgcgtgtgcgtgtgcatggtccaggacttcagtctggcatc
accaacaaacctaacaaatttaccgtggagacccgtggggctggtactggtggactgggg
ctggctatggaaggaccttctgaggccaaaatgtcctgcaccgataacaaagatggcagc
tgttgtgttgaatacatcccatatgagccagggacatacaacctcaatgtcacctatgga
ggccaaccaatcactggaagccctttctctgtacctgtccatgatactgttgacccaact
aaagtgaaatgtcagggccaggggcttggaaacaacgtgcgtgccaatatcccacaggtc
ttttctgtggatgcaagcaaggctggtatggcgccactgcaggtcagagttcagggaccc
aaaggtgttgtggagcctgctgaggtggtggataatggtgaccagactcacacagtcagc
tatgtgcccacaagagaggggccatactccattaatgttctgtatgctgatgaggagatc
ccacagagtccttataaggtgaaggttctgcccactcatgacgcaagtaaagtccgttgc
agcggtcctggcctgaataccactggtgttcctgccagtctgcccgtggagttcactatt
gacgccaaagatgcaggagagggactgttggccgtccagataactgaccctgatgggaag
ccaaagaaggctaacattcgtgataatcaggacgggacctaccttgtgtcctatgtgcct
gacatgaccggccgttacaccattcttattaagtatggtggtgatgagatcccgtattct
ccatatcgcattcgagccctgcctactggagacgccagcaagtgtacagtcacagtctca
attggaggtcatggtttgggagctggagttggtccgactattcagattggagagcagact
gtcatcactgtggatgcgaaggcagctgggaagggcaaggtgacctgtaccgtgtgcaca
cctgatggaggcgaggtggatgtggacgtcgtggaaaatgaggatggaacgtttgacatc
ttttacactgcaccgcagcctgggaaatacgtgatctgtgtgcgcttcggtggagagcac
atccctaacagccccttccaagtcacggctacagatgggcaattgggtatgaatggactg
gatgtagctggactgagaccctttgacttggtcattcctttcaccattcagaaaggagaa
attacaggtgatgtacgaatgccctctggaaaagtggccaagcctgatattacagacaac
aaggatggcacagtcacagtgaaatatgccccaactgaggcgggcctgcatgagatggac
attaaatatgatggaatacacattccaggaagtccattgcaattctacgtggattatgtc
aacagcggtcatgtgactgcatatggtcctggtctaattcatggcatggtcaataagcct
gcagtcttcacagtcaacacaaaggatgctggagagggtggtctgtctctggccatcgag
gggccatcaaaggcagatatcagctgcactgataatcaggacggtacctgcactgtttca
tacctccctgttcttcccggagactacaatatcattgttaaatacaatgacaagaacatc
cccggcagccctttcatgtccaaaatcacaggtgacgactcgatgcgcatgtctcacctg
aaggtgggctcagctgctgacatccctctggacattggtgagcttgacctcagtcagctg
acagccacactcaccaccccatccggccgagaggagccttgcctgctcaagatgctcaga
aatgggcatgtgggaatttcctttgtgcccaaggaaattggcgagcatcttgttaacatt
aagaaaaatggacgccatattcctagtagccccatttctgtcatgatcaaccaatcagag
atcggtgatgccagccgtgtacgagtaactggtcaaggcctgagtgaagctcgcaccttt
gagcccgcagaattcatcattgacactagagatgcaggatatggtggactcagtttgtct
attgagggacctagtaaagtggatatcaacactgaagatcaggaagatggcacctgcaaa
gtgacatattgccccacagagcctggaaactacataattaacatcaaatttgcagaccag
catgtgccaggaagtgctttcactgtgaaagtgacaggcgagggtcggatgaaggagagc
atcacccgcaaaagaagagctgcttctgtggccaatgttggcagccagtgcgacctcagt
ctaaagatccctgagatcagcattgcagacatgaccgctcaggtgaccagcccatctggc
aaagtccacaaggcagagataatggagggagaaaacaacacctactgcatccgattcgtg
cccacagagatgggtgtgcacacagtaagcgtgaagtatcaaggtcagcatgtgcctgga
tcccccttccagttcacggtgggacctcttggagaaggaggagctcataaagtcagagct
ggaggcccaggattagagagggcagaagctggtgtaccagcggagttcagcatttggact
cgtgaagcaggagctggtggtctgtccatcgcagtggaaggacccagcaaagcagagatt
gcttttgaagaccgtaaagatggatccagtggtgtctcttacatcgtccaggagcctggc
gattatgaagtatccatcaagttcaatgacgagcacatccctgacagtccgtttgtggtg
cctgtggcctcgccatctgacgatgcccgccgtctcactgttgccagtcttcaggagtcc
gggttaaaggtgaaccagccggcctcttttgctgtgagcctaaatggggcgaaaggagtc
atcgatgccaaagttcacagtccatcaggagcacttgaagagtgctgcgtcaccgagatc
gatgaagataaatatgctgtgagattcattcccagggagaatggattgtacctgatagat
gtgaaatttaatggttctcacatccctggaagccccttcaagatccgtgttggtgagacg
ggtcaggctggagatccaggaatggtgtctgcttatggagctggtctggaaggaggcact
actggatcgccttgtgagttcattgtaaacaccagttcagctggccctggagctttggcg
gtgactatcgacgggccgtccaaggtgaagatggactgtcaggaatgcccagagggctac
aaagtcacctacacacctatggcccctggaaactacctaatttctattaaatacggtgga
ccgtaccatattgttggtagtccattcaaagctaaaattactggctcccgattggtcaac
agccacagcatgcatgagacttcatcagtactggttgaccctgtgacccgcagcatgacg
accagccagcaggcagcgccaggctgggccagctctgatgccagccgcgtagtggccaaa
ggtttggggctcaacaagggcttcataggacagaagaacactttcagtgtggactgtagt
aaagcagggaggaacatgctcctggtcggagtggatggacccaaagtgccctgtgaggag
atcctggtgaaacacctgggcaaccgcctctacaacgtttcctaccagctgaaggagaaa
ggagagtacattctggtggtcaaatggggtgatgagcacatcccgggcagcccgtatcac
atcactgtctag

DBGET integrated database retrieval system