KEGG   Danio rerio (zebrafish): 562552Help
Entry
562552            CDS       T01004                                 

Gene name
zgc:171775
Definition
(RefSeq) uncharacterized protein LOC562552
  KO
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Cellular senescence
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
AGE-RAGE signaling pathway in diabetic complications
Salmonella infection
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    562552 (zgc:171775)
   04370 VEGF signaling pathway
    562552 (zgc:171775)
   04068 FoxO signaling pathway
    562552 (zgc:171775)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    562552 (zgc:171775)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    562552 (zgc:171775)
   04621 NOD-like receptor signaling pathway
    562552 (zgc:171775)
   04622 RIG-I-like receptor signaling pathway
    562552 (zgc:171775)
  Endocrine system
   04912 GnRH signaling pathway
    562552 (zgc:171775)
   04914 Progesterone-mediated oocyte maturation
    562552 (zgc:171775)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    562552 (zgc:171775)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    562552 (zgc:171775)
  Infectious diseases
   05132 Salmonella infection
    562552 (zgc:171775)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     562552 (zgc:171775)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   562552 (zgc:171775)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
Position
23
AA seq 359 aa AA seqDB search
MASPLKTGFHRLDIQKTTWDVPDRYTSLKPVGSGAYGTVCFAVDQKTKEKVAIKKLYRPF
QSLIHAKRAYRELRLLRHIQHDNVICLLNVFTPDSSLEKFDTFYMVMPFVAQDLGHIMKR
KQLTSNVITYLFYQILRGLKYIHSAGIIHRDLKPNNLAVDENCELKILDFGLARHTETEM
TGYVVTRWYRAPEVIFNWMHYTQTVDVWTAGCILAEMITGEVLFPGSDSIDQLKKILNLT
GTPNSTLVLKMQSKDAQSYVRSLPVQKKKAFKEVFSGMDPNAIDLLEGMLVLDPEVRLSA
KNGLSHPYLSEFHDPENEPVSPPYDDSFESMDLAVSEWKSLIHMEIMTFDPNNPRVTAM
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccctctgaaaacgggcttccacagactggacatccagaaaactacgtgggat
gtccctgaccgatacacctctctcaagcctgttgggtctggagcttatgggacagtgtgt
tttgcagtcgaccagaagaccaaggaaaaggtggccattaaaaagctgtacagaccattc
cagtctctgatccatgctaaacgagcctatagagaactccggctgctgcgtcacatccag
catgacaatgtgatctgcctgcttaatgtcttcacccctgattcttcgctggagaaattt
gatacgttctatatggtgatgccttttgtagctcaagatcttggacacataatgaagagg
aaacaattaaccagcaatgtcatcacttacttgttctatcagatactgcgaggactaaag
tatatccattctgctgggatcattcatcgggatcttaagcctaacaaccttgcagtggat
gaaaactgtgagttaaagatcctggactttggactggcaagacacactgaaactgagatg
acaggctacgtggtgacacgctggtacagagcacctgaagtcatcttcaactggatgcat
tacactcaaacagtcgatgtttggactgctggctgcatcctggctgagatgataacagga
gaagtgcttttcccaggcagtgacagtattgaccagctgaagaagatcctcaatctgaca
gggacaccaaactcaacgctggttctgaaaatgcaaagcaaagatgcgcagtcgtatgtc
cgctctcttccagtccaaaagaaaaaggccttcaaagaggtgttttctggaatggatcca
aacgccatcgatctgttggaaggtatgctggttttggacccagaggtgagactttctgca
aaaaatggcctttcacatccgtacctctctgagtttcatgaccctgaaaatgagcccgtg
tctcctccatatgatgattcctttgagagtatggatctggctgtcagcgaatggaaaagt
cttatccacatggaaatcatgacatttgaccccaacaaccccagagtgactgcaatgtaa

DBGET integrated database retrieval system