KEGG   Danio rerio (zebrafish): 562569Help
Entry
562569            CDS       T01004                                 

Gene name
plcd3b, si:dkeyp-94b4.3
Definition
(RefSeq) phospholipase C, delta 3b
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    562569 (plcd3b)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    562569 (plcd3b)
   04070 Phosphatidylinositol signaling system
    562569 (plcd3b)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    562569 (plcd3b)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     562569 (plcd3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
12
AA seq 769 aa AA seqDB search
MLRKKKTEAGMSQLKPDNPLIKMGVQDDEDVKMMLQGSSVTKVRSPRWKRKRMLKLMNDG
VTVWCESNKATSRAKSQQSFSVAEVECVLEGCKSETLRNQAASLPEEQCLTIVFKGGRKS
LDVQCDTTEEAQHWVHGIRTLQGRVNNMTQKEKLDNWIYGYLKQADINHDGKMSYEEVQV
LFKLVNIDLNEEYAASLFKKSDKSADGRLEHEEIELFCRELLRRPELDAVFQQYSANGCV
LSTVDLREFLKDQGEDHTLVHAQSLILTYELNEWAQKNQFMTANGFTMYMLSKENDVYNP
DHRRVYQDMSHPLSHYFISSSHNTYLTKDQLISDSSVHPYIRALSQGCRCVELDCWDGEK
EPVIYHGHTLTSKVPFSDVVKIIAEYAFTTSPYPLILSLENHCSVEQQTIMAQQLRSILG
DKLLSKPLNDKPLQYLPSPEDLKGKILMKAKKIKVEQDSSSSDSSSSDDESKADCKPKPE
KRDCKLSSELSDLVVYTSSVAFKQFDPSAKKAPNEMSSFSESDALKLIKESGKLFVRHNS
VQLSRIYPSGQRVQSSNYNPQDMWNAGCQIVALNFQTQSEEMDLNRGRFLANGNCGYVLK
PSFMCQPDSEFNPENTGGGPGYNPTLLTIKVISAQQLPKPDKEKLSSIVDPLVWVQIYGA
PIDNSTKKTHHINNNGFNPRWDCTFKFQLHVPELVLIRFMVEDHDYTTRNDFLGQFTLPF
PSLRTGYRHVRLLNADGCSISPSSLFIHVKITPGFSSPTRKVVAHSARE
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgttgagaaagaagaagactgaagccgggatgtcccaacttaaaccagacaatcctcta
ataaaaatgggagttcaagacgatgaggatgttaagatgatgctacagggctcctctgtg
acgaaggtgcgttctccacgctggaagaggaaacgaatgctaaagctgatgaatgatggg
gttacagtctggtgtgaatccaacaaggccaccagcagagccaaatctcagcagtcattc
tctgtagcagaggtggagtgtgtactggaaggctgtaagtctgagacgttgagaaaccag
gccgcctcactcccagaagaacagtgtctcaccattgtgttcaaaggaggaagaaagagc
ttggatgtccagtgtgacacaacagaggaagcccagcactgggtccatggcattcgaacc
ctccagggcagagtcaataacatgacccagaaagaaaaactcgacaattggatctatggc
tacctgaaacaagctgacataaatcatgatggcaagatgtcatatgaggaggttcaagtc
cttttcaagctggtcaacatagacctgaatgaagaatatgctgccagcctttttaagaaa
agtgataaatcagcagatggacggcttgaacatgaggagatcgagctattttgccgtgag
ttgctacgtcggccagagttggatgcagtgtttcaacagtactctgcaaacggttgtgtc
ctgtccactgtggatttgcgggaattcctgaaagatcagggcgaggaccacacccttgta
catgcgcagagcctcatcctcacctatgagctcaatgaatgggcccagaagaaccaattc
atgacagcgaatggcttcaccatgtacatgctgtctaaggagaatgatgtgtataaccca
gatcacagaagagtataccaggacatgagccacccattaagtcactactttatctcctca
tcacacaacacctacctcactaaagaccagctcatcagtgatagtagcgttcacccttac
ataagagctctaagtcaaggctgtcgctgtgtggagctggactgctgggatggagaaaag
gagccagttatttaccatggacacaccctcacatccaaagtgccatttagtgatgtggtg
aagatcatcgctgaatatgctttcacgacttctccatatcctcttattctgtctctggag
aaccactgctctgtggagcaacagacaatcatggcccagcagttgcgctcaattctgggg
gacaaactgctcagcaaacctctcaatgacaagccacttcaatacctgccatcaccagag
gatctaaaagggaagattttgatgaaagcaaagaagatcaaagtggagcaggacagctcc
agctccgactcaagctcctcagatgatgaatctaaagctgattgtaaacctaaaccagag
aagagagactgtaagttgagttctgaactgtctgatctggtggtttatacctccagtgtt
gcctttaaacagtttgatccatccgccaagaaagctccaaacgagatgtcctctttctct
gagagtgatgcgctgaaacttatcaaagaatcaggaaaactgtttgtacgtcacaacagt
gttcaactgagccgaatctatccatctggtcagagggtgcagtcttctaactacaaccct
caggacatgtggaatgctggttgccagatagtggcactgaacttccaaacccaatctgaa
gagatggatctgaacagaggccgtttcttagcaaacggaaattgcggctatgtgctaaaa
ccaagctttatgtgccagcctgattcagagtttaacccagaaaacactgggggaggtcct
ggctacaacccgacactactaactatcaaggtgatttcagcccagcagctgcctaaacct
gacaaagaaaagctcagctccattgtggaccctcttgtttgggtccaaatttacggggct
cccatagacaacagcacgaagaagacacaccatattaacaataatgggtttaaccctaga
tgggactgtacctttaagttccagcttcatgtgccagagctggtgttaatccgctttatg
gtcgaggaccatgactacaccaccaggaatgattttcttggccagtttacacttccgttc
ccaagcttgcggacaggttacaggcacgtgcgccttttgaatgcagatggctgtagcata
tcgccctccagtctcttcattcatgtcaaaatcacacctggattcagcagccccacaaga
aaagtagtcgcacatagtgcccgagaataa

DBGET integrated database retrieval system