KEGG   Danio rerio (zebrafish): 562720Help
Entry
562720            CDS       T01004                                 

Gene name
mapk8a, zgc:172209
Definition
mitogen-activated protein kinase 8a (EC:2.7.11.24)
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Adipocytokine signaling pathway
Salmonella infection
Herpes simplex infection
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dre04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:dre04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:dre04012]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dre04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dre04068]
Cellular Processes; Cell communication; Focal adhesion [PATH:dre04510]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:dre04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:dre04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:dre04622]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:dre04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:dre04920]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:dre04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:dre04914]
Human Diseases; Infectious diseases; Salmonella infection [PATH:dre05132]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:dre05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
13
AA seq 427 aa AA seqDB search
MNKNKREKEFYSVDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDNNLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIMAEMVRGSVLFPGSDHIDQWNKVIEQ
LGTPTQEFLLKLNQSVRTYVENRPRYTGYSFEKLFPDVLFPADSEHSKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPAEVEAPSPLITDKQLDEREHTVEEWKELIYKEV
LDWEERMKNGVIRGQPSPLGAAVINGSPQPSSSSSINDVSSMSTEPTVASDTDSSLEASA
GPLSCCR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaataagcgagagaaagaattctacagtgtagatgtgggggattcgacattc
acagtgttgaagcgctatcagaatctaagacccattggctcgggtgctcagggaatagtc
tgctcagcgtatgacaacaacctcgagcgaaacgtggctataaagaaactcagccggcct
tttcaaaatcaaactcatgccaaacgtgcgtacagagagctggtgctcatgaaatgtgtc
aaccataaaaatataataggcctcttaaatgtttttacaccgcaaaaaacattagaagaa
ttccaagatgtttacctagtaatggagctgatggatgcgaacctctgccaagtcattcag
atggagctggaccacgagcggctgtcctatctgctgtaccagatgctgtgtggaataaaa
cacctccacgcggcggggatcatccacagggacctgaaacccagtaacatcgtggtaaag
tcagactgtaccctgaagatcctggatttcggtctggcgcggacagcagctacaggtctg
ctgatgacaccatatgtggtgacccgttactacagagcccctgaagtcatcctgggaatg
ggatatcaagccaatgtggatgtgtggtctgtcggctgtatcatggctgaaatggtcaga
ggtagtgtattatttccgggttcagatcatattgatcagtggaataaagtaatagagcag
ctgggaacgccaactcaggagttcttgttgaaactcaaccagtctgtgcggacctatgtg
gagaacaggccccggtacactggatatagctttgagaagctgtttcctgatgtcctgttc
cctgctgattcagaacacagcaaactaaaagcgagtcaggcgcgggacctgctgtctaaa
atgctggtgattgatgcatcaaaacgaatctcggtggatgaggctttgcagcacccctac
attaacgtgtggtacgacccggctgaagtggaagcgccttctcctctgatcacagacaaa
cagctcgatgagagggaacacacagtggaagagtggaaagaactgatctataaagaagtg
ctggattgggaagaacggatgaagaacggtgttattcgaggtcagccctcccccctaggt
gcagcagtgatcaacggctcaccccagccctcatcctcatcctccatcaacgacgtgtcc
tccatgtccacagagcccaccgtggcctcagacacagacagcagcttagaggcctcggcg
ggacccctgagctgctgcagatga

DBGET integrated database retrieval system