KEGG   Danio rerio (zebrafish): 562779Help
Entry
562779            CDS       T01004                                 

Gene name
usp34
Definition
(RefSeq) ubiquitin specific peptidase 34
  KO
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     562779 (usp34)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   562779 (usp34)
Ubiquitin system [BR:dre04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    562779 (usp34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Position
1
AA seq 3627 aa AA seqDB search
MCENCAELLEVLNEISDADSSDGLQLKKEHALRVFTYISTWTQRQCLCCFKEYKHLEVFS
QLVYALINLVIAQVTNLRDRLRCGDGNSRTEGAESDWGSAQPQPSPNEDEPLNVERDSAE
EDGGEEDGDQHKNQKQGVKPDPKPRLNEPAAGESENESSVDPFASWSTEDQEKLLLCAAK
IFQIQFPLYTAYKHNTHPTIEDISAQESNILGSFCDMNDVEVPLHLLRYVCMFCGKHGLS
LMKDCFEFGAPDTLPFPIAHAFITIVSNIRIWLHIPAVMQHIIPFRTYVIRYLCKLSDQE
LRQSAARNMADLMWSTVKEPLDSALCFDRESLDLAFKYFMSPTLTMRLAGLSQITNQLHT
FNDVCNNESLVSDTETSIAKELADWLINNNVVEHIFGPNLHIEIIKQCQVILNFLAAEGR
LSTQHVDCIWAAAQLKHCSRYIHDLFPSLIKNLDPVPLRHVLSLVSGLHPSAHTEQTLYL
ASMLIKALWNNALAAKTQLSKQSSFASLLNTNIPMGNKKGSPAGSPESSDNSDTHHSGGS
DMEMDEPIMSSGKRGQQRLSDTEESLQGSSDETANSGEEGSSSGRSEASSNEAGSSRASQ
SAGSPGSELHSDDMADSEALKEEEEEEEEEEDDDEDDEDDDEDDEDDRPVLASEGSPQKD
PREPSTSEMRKRKAGEALEDVQCPPERPGMSSGIPGSISSAPILSKTKSIPFTPEAAAAL
VASSSSSLRILDPCSSSVCLEGTSGDQTDPSQSQNPQQTQPEMGAVSQESACMPRPADFL
TEAMGNELFNCRRFISPQHHHHHHHHHHHHHHHHHXHHHDGHMVEDMLSADDVSCSSSQV
SAKSEKNMADFDGEESGCEEELVQINSHAELSSHLQQHLPNLASIYHEHLVQGPAVHKHQ
YSSSHAVTDINLDNVCKKGNTLLWDLVQDDNAIHLSEGLINEAEKLLCSLVCWFTDRQIR
MRFIEGCLENLANHRSVVVSLRLLPKLFGTFQQFGSSYDTHWITMWAEKELHMMKLFFDD
LLHYIQEVREQRHKFALYSHSAEVQVRLQFLTCVFSTLGSPDHFRLSLEQVDILWHCLVE
DSECYDDALHWFLNQVRSKDQHAMGMETYKHLFLEKMPQLKPETISMTGLNLFQHLCNLA
RLATSAYDSSSNCELCGMDQLWGIALRAQSADISRAAIQYINSYYISGKTGLEKEQEFIS
KCMESLMMASANLEKDAHSSLTIIERGLLLLKTHLEAFRRRFAYHLRQWQIEGTGISSHL
KALSDKQSLPLRIVCQPAGLPDKMTIEMYPSDQVADLRAEVTHWYENLQKDQLSQQAQLQ
EFGQTSRQQDFPGGLMGPVRMISSGHELTTDYDEKTLHELGFKDMQMVFVSLGAPRRERK
GEGVQLPASCLPPPQKEHIPMLLLLQEPHLTTLFDLLEMLACFKPPGPDRPQHSTESVRC
EELHLHAENLSRRVWELLMLLPTCPSMLQAFQNISDETGSDGLCWKDLLRIKSPHKLLYA
LEIIEALGKPNRRIHRESTGSYSDLYPDSDDSSEEQIENSKNTWSCKFVSSGGLQLLLDI
FNSAILEPKEQESWTVWLLDCLACLLKLICQFAVDPADLDLAYHDVFAWSGLTDTQRKRA
WPGKSRKTTGDHGKGLHIPRLTEVFLSLVQGTNLIQRLINVAYTYDNLAHRVLKAQSDHR
SRHEVTHYSMWLLVSWAHCCSLVKSSLADSEHLHDWLKKLTLLIPETAVRQEACSGLYKL
SLSGLEGGESINRSFLLLAASTLLKFLPDAQALKPLRVEDFEEEAMFRSGCKEYFWLLCK
LIDNIHVKDASQTTLLDLDALARHLADCIRSREILDQQDGAIEDDGLTGLLRLATSVLKH
KPPFKFSREGQEFLRDTYDLLFLLPSLKDRQQPKCKSPAARAAAYDLLVEVVKGSVENYR
LLHNWVMSQHMQASHAPYKWDYWPHDDVRAECRFVGLTNLGATCYLASTIQQLYMIPEAR
QAVFTAKYSEDIKHKTTLLELQKMFTYLMESERKAYNPRPFCKTYTMDKQPLNTGEQKDM
TEFFTDLITKIEEMSQDLKNTVKTLFGGVITNNVVSLDCDHVSQTAEEFYTVRCQVADMK
NIYESLDEVTIKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPRILSFNTMRYTFNMVTMM
KEKVNTHFSFPLRLDMTPYTEDFLMAKGDRKEGFRDDSDAKVAESYEYDLIGVTVHTGTA
DGGHYYSFIRDIINPHAYRNNKWYLFNDAEVKPFDSAQLASECFGGEMTTKTYDSVTDKF
MDFSFEKTHSAYMLFYKRVEVEEENGKDFNFDISPDLLEWIWHDNMQFLQDKNIFEHTYF
GFMWQLCSSIPSTLPDPKSVSLMTAKLSTSFVLETFIHSKEKPTMLQWIELLTKQFNNSQ
AACEWFLDQMADDNWWPMQILIKCPNQIVRQMFQRLCIHVIQRLRPVHAHLYLQPGMEDG
SDDMDGPVEDIGSRSCVTRFVKTLLSIMEHGVKPHSKHLTEYFAFLYEFAKMGEEESQFL
LSLQAISIMVHFYMGTKGPENPQVEVLSEEEEGEEDEEEDILSLAEEKYRPAALEKMIAL
ISLLVEQSRSERHLTLSQSDMAALTGGKGFPFLFQHIRDSINIRQTCNLIFSLCRYNNRL
AEHIVSMLFTSIAKLTPEAANPFFKLLTMLMEFAAGPPGMPSFASYILQRIWEVIEYNPS
QCLDWLAVQTPRNKLAHSWVLQNMENWVERFLLAHNYPRVRTSAAYLLVSLIPSNSFRQM
FRSTRSLHIPTRDLPLSPDTTVVLHQVYNLLLGLLGRAKLYVDVPVHGTTKLVQYFSFMT
YCLISKTEKLMFSSYFMDLWNLFQPKLSEPAIATNHNKQALLSFWYNVCVDCSENVRLII
QNPVVTKNIAFNYILADHDDQEVVLFNRGMLPAYYAILRMCCEQSPAFTRQLASHQNIQW
AFKNLTPHASQYPGAVEELFNLMQLFVAQRPDMREEELEDVKQFKKTTISCYLRCLDGRS
CWTTLISAFRILLENDEDRLLVVFNRGLILMTESFNTLHMMYHEATACHVTGDLVELLSI
FLSVLKATRPYLQRKDVKQALIQWQERIDFAHKLLTLLNSYSPPELRNACLDVLKELVLL
SPHDFLHTLVPFLQHNHCTYHHSNIPMSFGPYLPCRENIKLMGGKNNIRPPRPELNMCLL
PSMVETSKGKDEVYDRMLLDYFLSYHQFIHLLCRVAINCEKFTETLVKLSVLIAYEGLPL
HLALFPKLWTELAQSQCAMAQSCVKLLCEDPAFGEYMKCILMDERNFLNNTIAYSFLTCF
LHKVQVQVLSGQSCSNLVNVLVTNLLNEYHSLQPELTNQRAELSKTSSLLNADLRALLLV
LSVYSPQQMDAALAPALQELLVKCRLCLQQRSTLEMEAKERKAKVEEEGVTPVKRRRVSS
SAEDRPVEGSLCPASTSSSLAPCSVQKAEPGEALTPTSTSDTETRDSSLIDPGTENDPPS
PDSASLEEKKMEASSSSSSSSSSSSSSLPDAFSRVDEPPPPQVSAREEEEEEEEQRKEVP
DQEAEPEREEMPSTSSSSSSADSVLLLSNLPDSAEGRSCTLQEAESGVCGHAPTQDTLEM
LSRTVEATIAVVAKLSNGKGGSRPSAL
NT seq 10884 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgagaactgcgccgagctgctggaggtgctcaatgagatctcggatgcagacagc
tcagacggcctgcagctgaagaaggaacatgccttaagagtcttcacatacatcagcaca
tggacacagaggcagtgtctgtgctgttttaaagaatacaagcacctcgaggtgttcagc
caactggtttatgccctcattaacttggtaatcgcccaagtgaccaaccttagggaccgc
ctacgctgtggcgatggcaacagtaggactgaaggggcggagtctgactggggctccgcc
caaccacagccttcacccaatgaggacgagcctctgaacgtggaacgggactctgctgaa
gaggacggtggagaagaggatggagatcagcacaagaaccaaaagcaaggggtcaaaccg
gaccctaaacccaggctcaatgagccagcggcgggggagagcgagaacgaaagcagcgta
gacccgtttgcatcctggagcacagaagaccaggagaaactgctgctgtgtgctgcaaag
atcttccagattcagttccctctatacacggcctacaaacacaacacacatcctactata
gaggatatctcagcacaagagagcaatatcctcggctctttctgcgatatgaatgacgtg
gaggttcctctgcacctgctgcgctacgtgtgtatgttctgtgggaaacacggcctctct
ctgatgaaagattgctttgagttcggagcccctgatactctccccttccccatcgcacat
gccttcatcaccatcgtctctaacatcagaatatggttgcacattcccgctgtgatgcag
cacatcatcccttttcgcacttatgttatcaggtatctgtgtaagctgtcagatcaggag
ctgcgtcagagtgctgcacgtaacatggcagatctgatgtggagtacagtgaaggagccg
ctggacagtgctctgtgcttcgacagggagagtctggatctggccttcaaatacttcatg
agtcccacactcaccatgagactcgctggactgagccagatcacgaatcagctgcacacc
ttcaatgacgtctgtaacaacgagtcgctagtttctgacaccgaaacgtcgatagcgaag
gagctggctgactggctcatcaataataacgttgtggagcacatattcggaccaaatttg
cacattgagatcattaaacagtgccaagtgatcctgaactttttggctgctgaaggaagg
ctgagcacccaacatgtggactgtatatgggctgccgctcagctgaaacactgcagccgc
tacatccacgatctgttcccctcactcatcaaaaacctggaccctgttcctctgcgccac
gtgcttagtctggtgtctggattgcaccccagcgcacacactgaacagacgctgtattta
gcctccatgttgatcaaggccttgtggaataatgcactggcagctaaaacccagctgtcc
aaacagagctccttcgcctcgctgctcaacaccaacattcccatgggcaacaagaaagga
tctcccgcaggaagccctgagagcagtgacaacagcgacacgcatcacagtggaggaagt
gacatggagatggacgagccaatcatgagcagcgggaaacgaggccagcagaggctatca
gatactgaggagtctctgcagggcagttcagacgagacggcgaacagtggagaagaaggc
agcagcagcggccgcagcgaggcctccagtaacgaagcaggatccagcagagccagccaa
tccgcaggcagcccgggcagcgagctccactccgacgacatggccgacagcgaagccctg
aaggaggaggaagaggaggaggaagaagaggaagacgacgatgaagatgacgaagatgat
gacgaggacgacgaggacgacagacctgttttggcttccgaaggcagccctcagaaagac
ccccgagagccgtccacgtcagaaatgcgcaaacgaaaagccggggaagcgcttgaggat
gttcagtgtcctccagagcgtcctgggatgtcatccggcattcctggatcaatttcctcc
gctcctatactttccaaaaccaaatccatcccattcaccccagaggcggccgccgcattg
gttgcctcatcttcctcctcgctcaggatcctggacccgtgctcctcttctgtgtgcctg
gagggaacgtcaggagatcagaccgatccctctcaatcccagaatccccagcaaacacag
ccggagatgggggctgtttcccaggagtccgcctgcatgccccgacccgccgacttcctg
acggaggccatggggaatgagctgttcaactgcaggcgtttcatcagtccgcagcaccac
catcaccaccaccaccatcatcaccatcatcatcatcaccaccatncccaccatcacgac
ggtcatatggtagaggacatgctgagcgccgatgacgtgagctgcagcagttcccaagtc
agtgccaaatcagagaagaacatggcagattttgatggagaggagtccggctgtgaagaa
gagctcgtccagatcaactctcacgctgagctcagctcacacctgcagcagcacctgccc
aacctggcctccatataccacgaacacctggtgcaaggtccggctgtgcacaaacatcag
tactcctcctcccatgcggtgactgacatcaacctggacaacgtctgtaagaaaggaaac
actcttctgtgggacctggtgcaggatgacaacgcgatccacctatcagaaggcctgatc
aacgaggcggagaagctgctgtgttctctggtgtgctggttcacagaccgtcagatccgc
atgcgctttatcgagggctgtctggagaacttggccaaccacaggtcagtggtggtgtct
ttacgtttgctgccaaaactcttcggaaccttccagcagttcggctccagctacgacact
cattggataaccatgtgggcagaaaaggagctgcacatgatgaagctcttctttgatgat
ctgttacactatattcaggaagtccgagagcagcgccacaagtttgctctgtacagtcac
agtgcggaggtgcaggtgcgtctgcagttcctcacctgtgtgttctcaacactcggctca
cctgatcacttcagattgagtctggagcaggtggacatcctgtggcattgtctagtagag
gactcagagtgttacgatgatgccctgcactggttcctcaaccaggtccgcagtaaagac
cagcacgccatgggcatggagacatacaagcatctcttcctggagaagatgcctcagctg
aagccggagaccatcagtatgacgggactcaacttgttccagcatctgtgtaatctggcc
cgtctggccaccagcgcctacgacagcagctccaactgcgagttgtgtggtatggatcag
ctgtggggaatcgcgctgagggctcagtctgcagatatcagccgtgccgccatccagtat
atcaactcctattacatcagcggtaaaacgggccttgagaaggagcaggagttcatcagt
aagtgtatggagagcttgatgatggcgtctgctaacctggagaaagacgctcactccagc
ctgaccatcatcgagagaggcctgctgctgctcaaaacacacctggaggccttcagacgc
aggtttgcgtatcacctgcggcagtggcagatcgaggggacgggcattagcagtcatctg
aaagctctcagtgataagcagtctttgccgctcagaattgtgtgccagcctgcaggactc
ccggacaagatgaccattgagatgtaccccagtgatcaggttgctgatctgagggcagag
gtcactcactggtatgagaacctccagaaggatcagctcagtcagcaggcacagctgcag
gagttcggccaaaccagccgccagcaggacttcccaggtggtctgatgggtccggtgcgc
atgatctcatcaggacacgagctgaccaccgactatgatgagaagacccttcatgagctc
ggcttcaaggacatgcagatggtgtttgtgtctctgggtgctccacgaagggagaggaag
ggtgagggtgtccagctgccagcgtcctgtctgccgccgcctcagaaagagcacatcccc
atgctgctgctactgcaggagccacatctcactacactgttcgacctgctggagatgctg
gcctgctttaaaccacccggccccgacagaccccagcacagcactgagagcgttcgctgt
gaggagctgcatctccacgctgagaatctctcccgcagagtctgggagctgctcatgctt
ctgcctacatgtcccagcatgctccaggccttccagaacatctctgatgaaacgggatca
gacggtttgtgctggaaggatctgctgagaatcaagagtcctcataagctgctctatgct
ttagaaatcatcgaggccctcggaaaacccaaccgcaggattcaccgcgagtccacgggc
agttacagcgatctatatccagactctgatgactccagtgaggagcagatcgagaacagc
aagaacacgtggagctgcaagtttgtgtcgtctggaggtcttcagcttctgctggacatt
tttaactctgcaattttggagccgaaagaacaagaatcctggacagtgtggctgctggat
tgtctggcgtgtctgctgaagctgatctgtcagtttgcggtggatccagctgatctggat
ttggcctatcatgacgttttcgcctggtctggcctcacagacacacagaggaagagagcg
tggcctggaaagtcccgcaaaaccacgggggatcatgggaagggcctgcatataccccga
ctcactgaggtttttctaagcctcgttcaaggaaccaacctcatccagaggctcatcaat
gtggcctacacatacgacaatctggcccacagggttctgaaggctcaatcagatcacaga
tccagacatgaagtgacgcattactccatgtggctgctggtcagctgggctcactgctgt
tctctggtcaagtccagcctggctgacagtgaacatctgcacgactggctgaagaagctc
acgctgctcattcctgaaacggcggtgcgtcaggaggcgtgtagtggtctctataaactg
tctctatcgggtctggaagggggtgaatccatcaacagatctttcctgctgctcgccgcg
tccacattactcaagttcctgccagacgcacaagcactcaaaccactgagggtggaggat
tttgaggaggaggccatgtttcgcagcggctgtaaggaatatttctggctgctctgtaaa
ctcatcgacaatatacacgtgaaagatgccagtcagaccaccctgctggacctggacgcc
ctggccagacacctcgctgactgcatccgcagccgggagattttggaccagcaggacggg
gcgatcgaggacgacggtctgacaggtctcctgcgtttggccaccagcgtcctgaagcac
aaacctccgttcaagttctctcgggagggtcaggagttcctcagggacacatatgacctg
ctgttcctgctgcccagcctgaaggaccgccagcagcccaaatgcaagagtcccgcagcc
cgcgccgccgcatacgacctgctggtggaggtggtgaagggctcagtggagaactacaga
ctgctgcacaactgggtcatgtcacagcacatgcaggcgtctcacgctccatataagtgg
gattactggccccatgatgacgtcagagccgagtgtcgttttgtgggcttgactaatctg
ggcgccacatgttacctggcctccaccatccagcagctctacatgatcccagaggcccga
caggccgtcttcactgctaaatattcagaggatattaagcataagaccacattgctggag
ctccagaagatgttcacgtatctcatggagagtgagaggaaggcgtacaaccctcgtccc
ttctgcaagacctacaccatggacaaacagcccctgaacaccggagagcagaaagacatg
accgagttcttcaccgacctcatcacgaaaatagaggagatgtctcaggacctgaaaaac
acagtcaaaacactgtttggaggcgtcatcaccaacaatgtggtttcactggactgtgat
catgtgagccagacggcggaggagttttacactgtgaggtgtcaggtggccgatatgaag
aacatctatgagtctctggacgaggtgaccattaaagacactctggagggcgacaacatg
tacacctgctctcagtgtgggaagaaagtacgggctgagaaacgagcttgtttcaagaag
ctgccgcggatcctgagcttcaacaccatgcgctacacgttcaacatggtgaccatgatg
aaggagaaggtgaacacacacttttccttcccgctgcggctcgacatgacgccctacacc
gaggacttcctcatggccaaaggagaccggaaggaaggttttcgtgacgacagtgatgcc
aaagtggcggagagttacgagtatgacctcatcggtgtgacggtgcacacaggaactgca
gacggcggccattattacagcttcatcagagacatcatcaacccacacgcctacaggaac
aataaatggtacctgtttaacgatgccgaggtgaagccgtttgattcagcgcagctggcc
tcagagtgttttggtggagagatgacgaccaaaacatatgattctgtcaccgacaagttt
atggatttctcctttgagaagacccacagtgcctacatgctgttctacaagagagtggag
gtggaggaggagaacgggaaagactttaactttgacatttctcctgatcttctggagtgg
atctggcatgacaacatgcagttcctccaggacaaaaacatcttcgagcacacgtacttt
ggcttcatgtggcagctgtgcagcagtattcccagcactttaccagatcctaaatctgtg
tctctaatgacggcgaagctcagcacatcgtttgttctggagaccttcattcactccaaa
gaaaagcccacaatgctgcagtggatcgagctcctgaccaaacagtttaacaacagtcaa
gctgcatgtgagtggtttctggatcagatggcagatgataactggtggcccatgcagatt
ctcatcaagtgtcccaatcagatcgtacgtcagatgtttcagaggttgtgtattcatgtg
atccagcgcctcaggccagtccacgctcacctgtacctgcagccgggcatggaggacggg
tctgacgatatggacgggccggtggaggacatcggcagccgctcctgtgtgacgcgattc
gtcaaaacgctgctgtccatcatggagcacggagtcaaaccacacagcaaacatctcact
gagtacttcgcctttctctacgagttcgccaaaatgggagaagaggagagtcagttcctc
ttgtctctgcaagccatctccataatggtgcatttctacatggggactaaagggcctgaa
aatcctcaggtggaggtgttgtctgaggaggaggagggtgaggaggatgaagaggaggat
attttgtctctggcggaggagaaatacaggccggccgctctggagaagatgatcgccctc
atatcgctgctggtggagcagtcccgctccgagagacacttgactctgtctcagagtgat
atggccgctctgactggaggaaaaggtttccctttcctgttccagcacatcagagacagc
attaacatcagacagacctgcaacctcatattcagcctgtgcagatacaacaaccgcctg
gccgaacacatcgtctcgatgctgttcacctccatcgctaaactcactccagaggcagcc
aaccccttcttcaagctgctgacgatgctgatggagtttgctgctgggcctccaggaatg
ccttcatttgcgtcctacatcctgcagaggatctgggaggtgatcgagtataacccgtct
cagtgtttggactggttggccgttcagacgccgcgtaataaactggcacacagctgggtt
ctgcagaacatggagaactgggtggagagattcctgctggcgcacaactacccgcgtgtg
cgaacctcggcggcgtatctgctggtgtccctcatcccgagtaactctttccgtcagatg
tttcgctccacgcgctctctccacatccccacacgggacctcccgctcagccccgacacc
accgtggttctgcatcaggtctataatcttcttctgggcctgttgggtcgagctaaactc
tatgtggatgtgcctgttcacgggaccaccaaactggtgcagtacttcagcttcatgacc
tactgcctcatctccaaaactgagaagctgatgttctccagctacttcatggacctctgg
aacctcttccagcccaagttatcagagccggccatcgccaccaatcacaacaagcaagct
ctgctgtcgttctggtataacgtctgcgtggactgcagcgagaacgtgcgcctcatcatc
cagaacccagtggtgactaaaaacattgcgttcaactacattctggcggaccacgatgac
caggaggtggtgctgttcaaccgcgggatgctgcctgcgtattacgccatcctgcgcatg
tgttgcgagcagtcgcccgccttcacccgccagctggcctcacaccagaacatacagtgg
gccttcaagaacctcacgccacacgccagccagtaccccggggcggtggaggagctcttc
aacctgatgcagctgtttgtggcacagaggcctgatatgagggaggaagagctggaagat
gtcaagcagttcaagaagaccaccatcagctgttacctgcgctgtctggacggacgctcc
tgctggaccacactcatcagtgccttccggattctgctggagaacgatgaggacagactg
ctggtggtgttcaacagaggactcatcctcatgaccgagtccttcaacaccctgcacatg
atgtaccatgaggccaccgcatgtcatgtgaccggtgatcttgtggagctgctctctatt
ttcctgtctgttttaaaggcaacacgaccctacttacagcgcaaagatgtgaagcaggct
ttgatccagtggcaggagaggattgactttgctcataaactgctgacgctgctgaactcc
tacagtcctccagagctgcgtaacgcctgtctggatgtgctgaaggagctggtgctcttg
agtcctcatgacttcctgcacacactcgtgcccttcctgcagcacaaccactgcacctac
catcacagcaacatccccatgtctttcgggccgtatctgccctgtcgagagaacatcaag
ctgatgggaggaaaaaacaacattcgtcctcccagacccgagctcaacatgtgcctgtta
ccctccatggtggagaccagtaagggtaaagatgaggtgtatgacaggatgttgttggac
tacttcctgtcgtaccatcagttcattcacctgctctgcagagtcgccatcaactgtgag
aagttcactgagactctggtgaagctgagtgtgctgatcgcttatgaaggacttcctcta
caccttgctctctttccaaaactatggactgaacttgcacaatctcagtgtgcgatggct
cagtcgtgtgtgaagctgctgtgtgaggatcctgcgtttggagaatatatgaagtgcatc
ctgatggacgagagaaacttcctcaacaacaccatcgcctattccttcctcacctgcttc
cttcataaagtgcaggtgcaggttttatcgggtcagagctgctccaatctggtgaacgtg
ctggtgacgaatctgctgaacgagtaccacagtctgcagcctgagctgaccaatcagaga
gcagagctgagcaagaccagcagcctcctgaacgcagatctgcgtgcgctgctgctggtt
ctgtcagtgtattctcctcagcaaatggatgcggctctggctccggctctgcaggagctg
ctggtcaaatgcaggctgtgtctccagcagcgcagcacactggagatggaggccaaggag
cgcaaagccaaagtggaggaggagggcgtgactccagtgaagcggcggcgagtgagcagc
agtgctgaagatcggccagtagagggcagtctttgccctgcctccacctcatcttcattg
gctccatgctctgtgcaaaaggcggagcctggagaggcgttaacgcccaccagcacctca
gacactgaaaccagagactcctcccttatcgacccgggaacagagaacgacccgccctct
ccagacagcgcatctctggaggagaagaagatggaggcgtcttcatcatcgtcatcctca
tcttcatcatcatcttcatccctgccagacgcctttagccgagtggacgagccaccgccg
ccgcaggtaagcgcaagagaggaggaggaggaagaggaagagcagcggaaggaggttcca
gatcaggaggcagagccagaacgagaggaaatgccctctacttcctcttcctcctcctcg
gccgactcggtgcttttactctccaatctgccggatagcgctgaggggcgcagctgcacg
ctccaggaggcggagtcaggtgtctgtggccacgcccccacacaggacactctagaaatg
ctgtcacgcacagtcgaagccaccatcgcagtggttgccaaactttcaaacggcaaagga
ggaagtcgaccctcggctttgtga

DBGET integrated database retrieval system